PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539485.1_FGP010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 204aa    MW: 23531.3 Da    PI: 8.052
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539485.1_FGP010genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.42.5e-251058250
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi+fs++gk+ye +
  KN539485.1_FGP010 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVFSPHGKIYELA 58
                       8*********************************************965 PP

2K-box58.92.2e-2080174598
              K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                        + +s+e++  +  qq++  L++e++ Lq+++R + Ge d++ ++l eLq+Le++Le  +++iRs+K++++ ++ie l++ke  l+ +n  L+
  KN539485.1_FGP010  80 QAESNEQNIPQVIQQDVLLLRQEVDLLQNSLRYMYGErDVSHMNLGELQSLESNLEVWVNNIRSTKMQIMSREIEMLKNKEGILKAANDILQ 171
                        4555777788999***********************978****************************************************9 PP

              K-box  96 kkl 98 
                        +++
  KN539485.1_FGP010 172 ERI 174
                        987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-28177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.24161IPR002100Transcription factor, MADS-box
CDDcd002651.89E-38275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-2383174IPR002487Transcription factor, K-box
PROSITE profilePS5129713.14689181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVIVFSP HGKIYELATN  60
GNMQGLIERY KNKSNLPEAQ AESNEQNIPQ VIQQDVLLLR QEVDLLQNSL RYMYGERDVS  120
HMNLGELQSL ESNLEVWVNN IRSTKMQIMS REIEMLKNKE GILKAANDIL QERIIAQTSI  180
MDVGCNMMIP QVPFQLTTES NYYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A3e-15184183MEF2 CHIMERA
6byy_B3e-15184183MEF2 CHIMERA
6byy_C3e-15184183MEF2 CHIMERA
6byy_D3e-15184183MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539485.1_FGP010
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194477.11e-120MADS-box transcription factor 26-like
RefseqXP_020194478.11e-120MADS-box transcription factor 26-like
SwissprotA2YQK92e-77MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G82e-77MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA2XTV61e-149A2XTV6_ORYSI; Uncharacterized protein
STRINGONIVA04G12010.11e-149(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-58AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]