PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539415.1_FGP009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 593aa    MW: 66688.9 Da    PI: 6.1783
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539415.1_FGP009genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.81.5e-882145832373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        + lL++cA+a+++++++ a +lL++++++   +gd+mqR+a+yf+++L+arla s+++ly+  +  +    + +e l+++kl+  ++ + k+
  KN539415.1_FGP009 214 RMLLIQCAQAMATDNQQSAGELLKKIKQHTLATGDAMQRVAHYFAKGLEARLACSGKHLYQ--NQVRL---SLVEYLKVYKLYMAACCFTKV 300
                        679*********************************************************5..33333...389****************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        + + a  +I++av+g++r+Hi+D++   G++Wp Ll+ L +R++gpp++RiT v+  ++g    +++ee g+ L++ A+e++vpf+f++++a
  KN539415.1_FGP009 301 ALMFAAMTIMQAVQGKKRLHIVDYGPRCGMHWPDLLRRLGNREDGPPEVRITIVDILQPGfrPFQRIEEAGHCLSSCANEFHVPFRFQAVAA 392
                        ********************************************************9999999**************************999 PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         +++++  e+L+++p+E+l+Vn  l+   l+desv  +   +rd  L+ + +++P+v++    + +h ++sFl rf   l yysalfd+l+a
  KN539415.1_FGP009 393 AKWKTVGAEDLHIEPDEVLVVNDLLSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGITNDSH-GASFLSRFRAVLLYYSALFDMLDA 483
                        9*********************************98776669*******************999998.789********************* PP

               GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                        + pr+s  r  +E+ +lg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r
  KN539415.1_FGP009 484 TTPRDSGLRLALEQNVLGPYALNAIACEGADLVERPEKYRQWQARNHRAGMQQLTLRPDIVDTIRDEVNKYHHKDFLLGEDGQWLLQGWMGR 575
                        ************************************************************************888***************** PP

               GRAS 366 pLvsvSaW 373
                         L++ SaW
  KN539415.1_FGP009 576 ILFAHSAW 583
                        ******** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.621187564IPR005202Transcription factor GRAS
PfamPF035145.1E-86214583IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENEAPS PPPVFFDLPP TPLANSDGTD PSSLDNQLLS YVSRMLMEDE  60
MGSSAAITNL QCVNRGSTEE ANNMLPSSEV VRAFSKGMEE ASKLLPRNNS FRTLETVDQV  120
SSDGHCRGRK NKNHDRDEQQ LEEELSRSSK LAALTIAGTQ EAGARELLDE LMLHTHETCI  180
KDMEKLRIDM DNEAEKKINK KDKKGSSSKV VDLRMLLIQC AQAMATDNQQ SAGELLKKIK  240
QHTLATGDAM QRVAHYFAKG LEARLACSGK HLYQNQVRLS LVEYLKVYKL YMAACCFTKV  300
ALMFAAMTIM QAVQGKKRLH IVDYGPRCGM HWPDLLRRLG NREDGPPEVR ITIVDILQPG  360
FRPFQRIEEA GHCLSSCANE FHVPFRFQAV AAAKWKTVGA EDLHIEPDEV LVVNDLLSFS  420
ALMDESVFCD GPNPRDVALR NISKMQPDVF IQGITNDSHG ASFLSRFRAV LLYYSALFDM  480
LDATTPRDSG LRLALEQNVL GPYALNAIAC EGADLVERPE KYRQWQARNH RAGMQQLTLR  540
PDIVDTIRDE VNKYHHKDFL LGEDGQWLLQ GWMGRILFAH SAWVRQSQDT SSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-302175838374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235240LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616387.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0BMG90.0A0A0E0BMG9_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g47920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-109GRAS family protein