PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539415.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 643aa    MW: 72287.7 Da    PI: 6.679
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539415.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS344.71.5e-1052696392373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lLl+cA+av+++d + a++lL ++++++s  gd+ qRla++f+++L+arla+++s++y++l +++ts   +++ l+a++l+ e++ + k+
  KN539415.1_FGP001 269 HNLLLHCAQAVATDDRRSAHELLRQIKQHSSAWGDAGQRLAHCFAQGLEARLAGTGSQVYQSLMSQRTS---VVDFLKAYRLYMEACCCKKV 357
                        689************************************************************999999...******************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        +++  N++I++av+g +++Hi+D+++s+G+QWp Ll++La+R++gpp++RiTg++ p++g   ++ +eetg+rL+++A+elgvpf+f+ ++a
  KN539415.1_FGP001 358 AFVFSNKTIYDAVAGRRKLHIVDYGLSYGFQWPGLLRELAARRGGPPEVRITGIDLPQPGfrPEQHIEETGRRLSRYADELGVPFKFHGIAA 449
                        ***********************************************************9*9***************************977 PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                        ++ e++   +L+ +++E+++V +  +  +++des++ +s   +rdevL  +++++P+v+++   +  ++++ Fl+rf eal+yy+a fd l+
  KN539415.1_FGP001 450 TKKESV---RLEAEEDEVVVVISLCHFRNVMDESLQEDSsrsPRDEVLGNIRRMRPDVFIHGIMNGAYGATYFLTRFREALYYYAAQFDLLD 538
                        777777...8999********************9988777779************************************************* PP

               GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                        a+++res+er+ vEr ++gr++ nv+acegaer+er e +++W++r ++aG++++pl+ +++  +   +r  + + + v+e++ +l+  Wk+
  KN539415.1_FGP001 539 ATVGRESQERMLVERDIFGRAALNVIACEGAERVERPEMYKQWQARNQRAGLRQLPLNPQVVRLVLDKVRDKYHKDFVVDEDQRWLLHRWKG 630
                        *******************************************************************999999888**************** PP

               GRAS 365 rpLvsvSaW 373
                        r L+++S W
  KN539415.1_FGP001 631 RVLYALSTW 639
                        ********* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.928242620IPR005202Transcription factor GRAS
PfamPF035145.2E-103269639IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MATTPEAEES LRFRWPAAEE EFDNDMVLPY ISRLLMEDDV HDHFFYQYPD HPALLRAQQP  60
FAQILAASSS PSSAGGASSS SSSDAPPSRG FFDDEAATAK TRATFPTSAV HSVDHQYSGG  120
LDMVNMAFLK GMEEANKFLP TNTLLLSTDS SSTLQLQGEV EVVVHEHGHG MLGVGGAAHG  180
HAAINSKKVN CRDDDLEAGT GRATKLMAPE PELEEEGARE MFDEMMLQEH EICMKGVKQL  240
SLKSKSSSSS SKKARGRRTV IHTEPVDLHN LLLHCAQAVA TDDRRSAHEL LRQIKQHSSA  300
WGDAGQRLAH CFAQGLEARL AGTGSQVYQS LMSQRTSVVD FLKAYRLYME ACCCKKVAFV  360
FSNKTIYDAV AGRRKLHIVD YGLSYGFQWP GLLRELAARR GGPPEVRITG IDLPQPGFRP  420
EQHIEETGRR LSRYADELGV PFKFHGIAAT KKESVRLEAE EDEVVVVISL CHFRNVMDES  480
LQEDSSRSPR DEVLGNIRRM RPDVFIHGIM NGAYGATYFL TRFREALYYY AAQFDLLDAT  540
VGRESQERML VERDIFGRAA LNVIACEGAE RVERPEMYKQ WQARNQRAGL RQLPLNPQVV  600
RLVLDKVRDK YHKDFVVDED QRWLLHRWKG RVLYALSTWV AQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-392726398374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616926.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0D3HQ940.0A0A0D3HQ94_9ORYZ; Uncharacterized protein
STRINGORGLA11G0190400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein