PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539253.1_FGP009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 336aa    MW: 36850.4 Da    PI: 6.6978
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539253.1_FGP009genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.64.9e-211053245
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                       + en+s r+vt+skRr gilKKA+ELS+LCd+   +++fs++gk
  KN539253.1_FGP009 10 KLENSSGRHVTYSKRRSGILKKAKELSILCDIPLILLMFSPNGK 53
                       679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-27160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.899153IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.93E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-16323IPR002100Transcription factor, MADS-box
PfamPF003194.7E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRHVT YSKRRSGILK KAKELSILCD IPLILLMFSP NGKPTICVGD  60
HSSIEDVITK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG FRAQTSDQSI  120
VLCQIQFQND MQLPLGLTGD PNTSSWFHGG GSAEAQQPMM LPEDPSLLHQ RDIGCSASTS  180
LQSYPGYFSM GKQSTDNAGG GEQHHHAAVQ QQQQPEFSQA DCLTSLQLGA QFPYPSAFDN  240
AGLLSDRLFD NAAAAAAAMD FGGHYDLPRP GDEASFQNWA SAACGATMYD HQQQQQQQQQ  300
PAQIMTESLT PHQLPAAATV EAPSFNHPSP HRQLMI
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539253.1_FGP009
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565050.0FM956505.1 Oryza sativa Japonica Group mRNA for MADS68 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021317426.11e-130agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_021317427.11e-130agamous-like MADS-box protein AGL65 isoform X1
TrEMBLB9G8P50.0B9G8P5_ORYSJ; Uncharacterized protein
STRINGOPUNC11G18320.11e-157(Oryza punctata)
STRINGLPERR11G18320.11e-157(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-52AGAMOUS-like 65