PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539230.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 989aa    MW: 109269 Da    PI: 8.8565
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539230.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.65.8e-08311403147
                        TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqk 46 
                        +++W+  E e+l++++kq   +                                              +W++Ia++   gR++ +c srw++
  KN539230.1_FGP001 311 KQPWSDVEKEKLAKGIKQQYQEalilnsinngsstgdfsavdmayaltntagnfevtpenlrsvlpliNWDKIAAMYLPGRSGAECESRWLN 402
                        79****************99999***************************************************99888************9 PP

                        H CS
    Myb_DNA-binding  47 y 47 
                        +
  KN539230.1_FGP001 403 F 403
                        7 PP

2Myb_DNA-binding29.41.9e-09411455246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        ++WT+ E+++l+  v+q G+++W  Ia t+g++Rt+ qc  r+q 
  KN539230.1_FGP001 411 NAWTAREEKRLILTVQQQGMNNWINIAVTLGTHRTPFQCLVRYQR 455
                        68**************************************99995 PP

3Myb_DNA-binding43.48.1e-14465508348
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         W +eEd++l  av+ +G++ W ++++ m  gRt++qc +rw+k l
  KN539230.1_FGP001 465 DWAEEEDLQLQAAVNTFGTN-WQLVSASMD-GRTGNQCSNRWRKTL 508
                        6*****************99.*********.************975 PP

4Myb_DNA-binding513.4e-16516561248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        grW+ +Ed++l  avk++G+g+W++Ia+ ++ gRt  qc +rw+++l
  KN539230.1_FGP001 516 GRWSLDEDKRLMVAVKLFGSGSWNKIAQFIP-GRTQSQCNERWRNVL 561
                        8******************************.************986 PP

5Myb_DNA-binding31.44.4e-10568612247
                        SSS-HHHHHHHHHHHHHTTTT-HHHHH.HHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIa.rtmgkgRtlkqcksrwqky 47 
                        g W +eEd +l+  v ++G+  W++Ia ++++ +Rt+++c  rw+k+
  KN539230.1_FGP001 568 GEWRPEEDSILLASVDEFGPC-WSKIAgAKIP-HRTDNMCLRRWRKL 612
                        68*****************88.****945777.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.377306404IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.9E-7307329IPR009057Homeodomain-like
SMARTSM007179.9E-6310406IPR001005SANT/Myb domain
CDDcd001677.19E-4369403No hitNo description
Gene3DG3DSA:1.10.10.603.9E-7376390IPR009057Homeodomain-like
SuperFamilySSF466898.58E-5379414IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-7391424IPR009057Homeodomain-like
PROSITE profilePS5129410.749405461IPR017930Myb domain
SuperFamilySSF466891.66E-21409504IPR009057Homeodomain-like
SMARTSM007176.6E-4409459IPR001005SANT/Myb domain
PfamPF002497.2E-6411455IPR001005SANT/Myb domain
CDDcd001671.46E-4412457No hitNo description
Gene3DG3DSA:1.10.10.602.4E-10425468IPR009057Homeodomain-like
SMARTSM007171.2E-11462510IPR001005SANT/Myb domain
PfamPF002493.7E-12465507IPR001005SANT/Myb domain
PROSITE profilePS500909.721466508IPR017877Myb-like domain
CDDcd001672.98E-9466508No hitNo description
Gene3DG3DSA:1.10.10.602.7E-14469511IPR009057Homeodomain-like
PROSITE profilePS5129419.971509565IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-18512563IPR009057Homeodomain-like
SuperFamilySSF466896.34E-26514609IPR009057Homeodomain-like
SMARTSM007173.0E-12514563IPR001005SANT/Myb domain
PfamPF002492.9E-15516561IPR001005SANT/Myb domain
CDDcd001671.99E-11517561No hitNo description
Gene3DG3DSA:1.10.10.603.9E-15564617IPR009057Homeodomain-like
SMARTSM007171.9E-8566615IPR001005SANT/Myb domain
PROSITE profilePS5129413.267568617IPR017930Myb domain
PfamPF002493.4E-8568612IPR001005SANT/Myb domain
CDDcd001677.53E-9569612No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 989 aa     Download sequence    Send to blast
MRAKVSDSSS STLTLDGSCF DFVGVLLFVY VCMVLAVEEE EDEAAQEEAP KDEAEIQAAL  60
AVVAVGAISI LASCWLFYCI SSALSTEEED EDLALVRSIR ENLLLNKASP SSPLPRPICA  120
WPPSDSEDDE DDLETLRAIQ RRFSHYHSGT SSGSEMNTKT EASKEGSGDI FGNELDEEFD  180
AEKHNKEATT RTGFPKAALL LVDALKKNRA CQKFIRRKMI TIEAKIEENK DLRDRVKCLL  240
DYQLSCRKAF GKILCQKEDP RVRLISSRKP CAQSTKNKDK KTPALFLGPA DNPHVSKYKM  300
VLKQLPMSLQ KQPWSDVEKE KLAKGIKQQY QEALILNSIN NGSSTGDFSA VDMAYALTNT  360
AGNFEVTPEN LRSVLPLINW DKIAAMYLPG RSGAECESRW LNFDDPLINH NAWTAREEKR  420
LILTVQQQGM NNWINIAVTL GTHRTPFQCL VRYQRSLNHC ILNKDWAEEE DLQLQAAVNT  480
FGTNWQLVSA SMDGRTGNQC SNRWRKTLNP ERSRVGRWSL DEDKRLMVAV KLFGSGSWNK  540
IAQFIPGRTQ SQCNERWRNV LDPDIDLGEW RPEEDSILLA SVDEFGPCWS KIAGAKIPHR  600
TDNMCLRRWR KLCQDKLPSV KAAQQIKKSI LQCNFVDRET ERPAIGPSDL MPLVRSKVDG  660
SDENTVSAKV RKPRKRSRIP CEDNVLPGDT SNSSPSMNLP LSESIDAEAA VNTTTTNSKK  720
KPSRSRSKKQ TDENLAVCDA NNSSNCSSGA RKRTRSITDK NQVVQKKMKG SISGDNEAVV  780
ETVGTISADN EVATKRKTGS TSVGEEGTTK KTTRGSLSGK GEVNKRMRGS ISGVQKGATK  840
QRMRGSVSTD NHGAVMKGKR APSRKSAKEN SKADSMANAA FGSDLPTVAS EDRVADNGNV  900
KNGRLKSMPR PKQINMTEGS ADKFSTSTRL ADCMSFGRIN GSSRVARHLY VSVKPLSNMI  960
QSNGHSDVSA KDPTSAGTDP TSVENSNTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-263826178159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-263826178159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654520.0AK065452.1 Oryza sativa Japonica Group cDNA clone:J013025M19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647437.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647436.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647435.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647433.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647432.10.0PREDICTED: myb-like protein L isoform X1
TrEMBLA0A0E0AK000.0A0A0E0AK00_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g04700.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA024846-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-149myb domain protein 4r1