PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539080.1_FGP007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 101aa    MW: 11196.9 Da    PI: 10.3424
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539080.1_FGP007genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.36.8e-134191555
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                       kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+++
  KN539080.1_FGP007 41 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLALLQDH 91
                       9******************************************99999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-1037101IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.8983990IPR004827Basic-leucine zipper domain
PfamPF001705.2E-124191IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-134191No hitNo description
SuperFamilySSF579591.13E-124195No hitNo description
CDDcd147035.32E-204289No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MSIKAEELVG ASPGTEGMSS AEAKKAVSAA KLAELALVDP KRAKRIWANR QSAARSKERK  60
MRYIAELERK VQTLQTEATT LSAQLALLQD HFGWFEEIRP V
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539080.1_FGP007
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0054921e-140AF005492.1 Oryza sativa bZIP transcriptional activator RF2a (rf2a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612692.15e-52transcription factor RF2a
SwissprotQ69IL44e-53RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A0E0M3F09e-51A0A0E0M3F0_ORYPU; Uncharacterized protein
TrEMBLA0A0E0QTU82e-52A0A0E0QTU8_ORYRU; Uncharacterized protein
TrEMBLQ0J0D18e-51Q0J0D1_ORYSJ; Os09g0516200 protein
STRINGORUFI09G17730.14e-53(Oryza rufipogon)
STRINGOPUNC09G14870.12e-51(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-15bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]