PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539071.1_FGP018
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 336aa    MW: 37542.6 Da    PI: 10.512
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539071.1_FGP018genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.37.6e-2590133144
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                        d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  KN539071.1_FGP018  90 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 133
                        79***************************************998 PP

2QLQ59.97.2e-211853237
                QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                       +FTa+Q+q+L++Q+l+yKy+a++ P+P++L++++++
  KN539071.1_FGP018 18 PFTASQWQELEHQALIYKYMASGTPIPSDLILPLRR 53
                       9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8011853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.7E-151851IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57390134IPR014977WRC domain
PfamPF088791.7E-2091133IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MMMMSGRPSG GAGGGRYPFT ASQWQELEHQ ALIYKYMASG TPIPSDLILP LRRSFLLDSA  60
LATSPSLAFP PQPSLGWGCF GMGFGRKAED PEPGRCRRTD GKKWRCSKEA YPDSKYCEKH  120
MHRGKNRSRK PVEMSLATPP APSSSATSAA LTPSSENHLK TRPRTPELAP KQTTISLFPP  180
GSRRAPNQPP MQHPNSPKPI PTTLTEIPPN PPAFAIPTTR RLHHTRNERR ERLTWPPSLA  240
GWPADRGRCR RRQQQQQQQQ HCFLLGADLR LEKPAGHDHA AAAQKPLRHF FDEWPHEKSS  300
KGSWMGLEGE TQLSMSIPMA ANDLPITTTS RYHNDD
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539071.1_FGP018
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2018950.0AF201895.1 Oryza sativa growth-regulating factor 1 (GRF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021316189.11e-103growth-regulating factor 1 isoform X1
SwissprotQ6AWY84e-83GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A0E0GDJ51e-134A0A0E0GDJ5_ORYNI; Uncharacterized protein
STRINGONIVA02G36590.11e-135(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-51growth-regulating factor 5