PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539010.1_FGP002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CAMTA
Protein Properties Length: 1019aa    MW: 114016 Da    PI: 6.7638
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539010.1_FGP002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1142.41.3e-441810431117
               CG-1  31 ktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylev 117
                         +rp++gsl+Lynr++ ryfr+DG+ w++kkdg+tv E+he+LKvg+v++l+cyYah+e+np fqrrc+w+Le ++e+ivlv+y+ev
  KN539010.1_FGP002  18 LDRPSCGSLFLYNRRVNRYFRRDGHAWRRKKDGRTVGEAHERLKVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQYREV 104
                        679**********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143759.8641110IPR005559CG-1 DNA-binding domain
SMARTSM010763.9E-463105IPR005559CG-1 DNA-binding domain
PfamPF038596.4E-3613103IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.108.2E-6377467IPR013783Immunoglobulin-like fold
SuperFamilySSF812965.77E-16377459IPR014756Immunoglobulin E-set
PfamPF018333.7E-7377458IPR002909IPT domain
SuperFamilySSF484032.8E-16408452IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.8E-16572669IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.2E-16572668IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029716.043574666IPR020683Ankyrin repeat-containing domain
CDDcd002042.83E-10579666No hitNo description
PfamPF127963.3E-7586668IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008810.927607639IPR002110Ankyrin repeat
SMARTSM002482.4E-4607636IPR002110Ankyrin repeat
SMARTSM002481800646675IPR002110Ankyrin repeat
SMARTSM0001527727749IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.529728757IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525401.14E-5783833IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS500967.547786815IPR000048IQ motif, EF-hand binding site
SMARTSM0001513787807IPR000048IQ motif, EF-hand binding site
PfamPF006120.0024788806IPR000048IQ motif, EF-hand binding site
SMARTSM000153.6E-5808830IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.798809837IPR000048IQ motif, EF-hand binding site
PfamPF006126.5E-5813830IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1019 aa     Download sequence    Send to blast
MSLSKRSSLI VSLVDSWLDR PSCGSLFLYN RRVNRYFRRD GHAWRRKKDG RTVGEAHERL  60
KVGNVDALSC YYAHGEQNPC FQRRCFWMLE PAYEHIVLVQ YREVGAAEGR YNSASLFNGP  120
TDSLSVLSYP NATYGNQYLG STSGVSDGSE SRHSNLSSVT EVSSYSANKD NGILQSIQEL  180
SQSTIMGAPA LGQSSLEQSI EVHRVDNSNS TNKSGLNRAL KQIVEQLSLG DDEDDDYIHQ  240
AQPFDFITNI EAPDRQRDAS RNVSEYQPPG GLYNSDMQQI SAAKRFLLET EDSIDSPSYN  300
YVPREEGNNG TNTLSVHDYS LQSSLNPDWK KTAPLTLQSN LYGSEIPSLL LDHGQFESLS  360
SGENTRLILG QNPRFSIREV SPEWTYCYEI TKVIITGDFL CDPSSSCWAV MFGDSEVPAE  420
IVQAGVLRCH TPLHSSGKLT ICVTSGNREI CSEVKDFEFR AKSTASSFLD ISPSSRSLKS  480
SEELLLLAKF VRMLLCENGS HTNSNGDPQS VQCPKLKMND EHWQRLIDEL KGGCENPLNV  540
SDWIMEELLK SKLQQWLSVK LQEYDGMACS LSKHEQGIIH LISALGYEWA LSSILSAGVG  600
INFRDTNGWT ALHWAAYFGR EKMVAALLAA GASAPAVTDP TAQDPVGKTA AFLASERGHL  660
GLAAYLSEVS LTSYLASLTI QESDTSKGSA AAEAERAVES ISQRNAQLHG GTEDELSLKD  720
SLAAVRNAAQ AAARIQNAFR AFSFRKRQQK TARLKDEYGM TQEDIDELAA ASRSYYQSLL  780
PNGQFYDKAA VSIQKKYRGW KRRRHFLNMH INVVKIQAHV RGHQVRKKYK TFVSTVSVLE  840
KVILRWRRKG HGLRGFRAEQ TAMAEAEEDD EDDDEDDFND DEAVKMFRRQ KVDESVKEAM  900
SRVLSMVDSP EARMQYRRML EEFRQATLTD QLKVFGQVTI KQSFTSPKKL RLIICITVSI  960
ACEDTNIIML DKGKSVEVMV AQRVYISLGR AKMRFSAKGN ESKAKLVGKY TPDVCFSYY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1220010.0AK122001.1 Oryza sativa Japonica Group cDNA clone:J033110J06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635911.10.0PREDICTED: calmodulin-binding transcription activator 4 isoform X2
TrEMBLB9FEW00.0B9FEW0_ORYSJ; Uncharacterized protein
STRINGORGLA02G0342600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62383241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67310.11e-147Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains