PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538930.1_FGP009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family FAR1
Protein Properties Length: 609aa    MW: 70930 Da    PI: 8.6242
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538930.1_FGP009genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR193.92e-2942129289
               FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                        fY +YA++vGFsvr+sks++s+++++i++r+fvCskeg++++++++t k++r+ra  r gC+a+++v++++  +w+v+kl +eHnH++
  KN538930.1_FGP009  42 FYMAYASRVGFSVRISKSRRSRNDESIIMRRFVCSKEGFHHKKQTDTGKRKRKRAIIREGCHAMIEVSQKYYRRWVVIKLIKEHNHAV 129
                        9*************************************************************************************97 PP

2FAR178.51.3e-24163250290
               FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        fY +YA+++GF+vr++ s++s +++++++r+fvC++eg +  e+++ ++++r+r + r gC+a++++ k++++kw+v+kl l H+Hela
  KN538930.1_FGP009 163 FYYAYASRMGFDVRIRLSRRSPKDETFVMRRFVCTREGATPCEENE-NRRKRNRGVPREGCQAMFEIVKKDQDKWVVSKLFLAHTHELA 250
                        9****************************************99999.999*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-2642129IPR004330FAR1 DNA binding domain
PfamPF031011.9E-21163250IPR004330FAR1 DNA binding domain
PfamPF044349.2E-8492530IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.324493531IPR007527Zinc finger, SWIM-type
SMARTSM005757.2E-6506533IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MMAFDVNSEP VDMNNTSSKA NLENSEPFVG MEFESEEAAK VFYMAYASRV GFSVRISKSR  60
RSRNDESIIM RRFVCSKEGF HHKKQTDTGK RKRKRAIIRE GCHAMIEVSQ KYYRRWVVIK  120
LIKEHNHAVA APSIVRYVAP EEYAQLEPLA GMEFPSYESA QTFYYAYASR MGFDVRIRLS  180
RRSPKDETFV MRRFVCTREG ATPCEENENR RKRNRGVPRE GCQAMFEIVK KDQDKWVVSK  240
LFLAHTHELA NVPNKVHYIQ SNSENWIAAM GSHHPTSLTT VYNEAIGSAI AKIFPQTHHL  300
YFTADILKRS KDILADIYFR HVSFEREFYV CINEPETIEM FELSWKKVLD KYDLYDNSWL  360
QSLYRIRQKW VPVYFKGVFT ADLSASQRPE SLRNIFEKYF NRRTALPVFI SLFEHLMAGW  420
SEREAVEDLA TSFTRPVLRT PSNMMKQVSE IYTTTVFNIL EEEFIGSLGY YISSLDNDGL  480
IAVYSVTKED TEATCRVRYD TSGNIAKCSC CKFESCGILC RHILRVFLAL DVRTIPDVYI  540
LKRWTKEAKN GFVLDECLRY SELHRDALRY AREGSTSGEV FTFAQQTLQV AFAEVVQMKQ  600
ETFSQYTIR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC0915320.0AC091532.14 Oryza sativa chromosome 3 BAC OSJNBa0078A17 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632991.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
RefseqXP_015632990.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
RefseqXP_015632989.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
RefseqXP_015632988.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
TrEMBLB8AQP20.0B8AQP2_ORYSI; Putative uncharacterized protein
TrEMBLB9FB800.0B9FB80_ORYSJ; Uncharacterized protein
TrEMBLQ10DV60.0Q10DV6_ORYSJ; Transposon protein, putative, unclassified, expressed
STRINGBGIOSGA009913-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g50900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-98FAR1-related sequence 5