PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538927.1_FGP014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 203aa    MW: 21057.8 Da    PI: 5.2031
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538927.1_FGP014genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.64.4e-1620492655
            G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  KN538927.1_FGP014 20 GATPKSVLELMDVKDLTLAHVKSHLQMYRT 49
                       59***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-141950IPR009057Homeodomain-like
SuperFamilySSF466891.24E-51950IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-112049IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MASATSTTPD LSLHISLASG ATPKSVLELM DVKDLTLAHV KSHLQMYRTV KSTDKPAAAS  60
GPMDGSGSGS GDDELLASDG RQATSSGADA DRRMSFTEHR SSSEGAASHA GGGGDGDCSS  120
SAVNSDTIRA RSNSPRGLWA LTSDLILADI LEMCNQGPLP VLLCPLLSLP LLPVSTDTAA  180
DILRKTLSIL KTDFCSLIKL FQI
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN538927.1_FGP014
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877881e-177AK287788.1 Oryza sativa Japonica Group cDNA, clone: J065172N06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695798.18e-57PREDICTED: probable transcription factor RL9
SwissprotQ0J2358e-24ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0D9X8053e-58A0A0D9X805_9ORYZ; Uncharacterized protein
STRINGLPERR08G12560.11e-58(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-16G2-like family protein