PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538873.1_FGP017
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LFY
Protein Properties Length: 247aa    MW: 27258 Da    PI: 9.6386
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538873.1_FGP017genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY401.41.1e-1222236161386
            FLO_LFY 161 agsggeglgeaelvaaeekkseeekkkaskk.kqkrkkkkelkseededeeeeededeeg........sgedgeerqrehPfivtepgevar 243
                        agsgg+g  +++  +++ kk+ ++ + a+k  k++rkk ++l+ + +ede +  ded+ g        +g +g erqrehPf+vtepgevar
  KN538873.1_FGP017   2 AGSGGMGDDDSGRRMVTGKKQAKKGSAARKGkKARRKKVDDLRLDMQEDEMDCCDEDGGGgsestessAGGGGGERQREHPFVVTEPGEVAR 93 
                        67888888888888887766666666665543667777777666644444443333333334455554888899****************** PP

            FLO_LFY 244 gkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGa 335
                        +kknGLDYLf+LyeqCr fLlqvq++ak +G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeas+alrra+k+rgenvGa
  KN538873.1_FGP017  94 AKKNGLDYLFHLYEQCRLFLLQVQSMAKLHGHKSPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASDALRRAYKARGENVGA 185
                        ******************************************************************************************** PP

            FLO_LFY 336 wrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                        wrqacy+plv+i+ar+g+didavf+ahprL+iWYvPt+LrqLCh++rs+++
  KN538873.1_FGP017 186 WRQACYAPLVDISARHGFDIDAVFAAHPRLAIWYVPTRLRQLCHQARSSHA 236
                        ************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.8E-1292236IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MAGSGGMGDD DSGRRMVTGK KQAKKGSAAR KGKKARRKKV DDLRLDMQED EMDCCDEDGG  60
GGSESTESSA GGGGGERQRE HPFVVTEPGE VARAKKNGLD YLFHLYEQCR LFLLQVQSMA  120
KLHGHKSPTK VTNQVFRYAK KVGASYINKP KMRHYVHCYA LHCLDEEASD ALRRAYKARG  180
ENVGAWRQAC YAPLVDISAR HGFDIDAVFA AHPRLAIWYV PTRLRQLCHQ ARSSHAAAAA  240
ALPPPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-101742422170PROTEIN LEAFY
2vy2_A1e-101742422170PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN538873.1_FGP017
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0056200.0AB005620.1 Oryza sativa mRNA for RFL gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635355.10.0probable transcription factor FL
SwissprotA2XX390.0FL_ORYSI; Probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A0E0H5F50.0A0A0E0H5F5_ORYNI; Uncharacterized protein
STRINGONIVA04G23030.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.17e-99floral meristem identity control protein LEAFY (LFY)