PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538847.1_FGP039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family YABBY
Protein Properties Length: 194aa    MW: 21603.8 Da    PI: 8.7234
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538847.1_FGP039genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY60.76e-19146146
              YABBY  1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsll 46
                       +d++s se++Cyv+C++Cnt+lav vP + l+ +vtv+CGhC +l 
  KN538847.1_FGP039  1 MDLVSPSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLS 46
                       578999************************************9984 PP

2YABBY95.21.5e-298114598162
              YABBY  98 seklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162
                           +s  ++e +pr+p v++PPek+ r Psaynrf++eeiqrika+ Pdi hreafs+aaknWa 
  KN538847.1_FGP039  81 LPLVSPTSNEGSPRAPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAK 145
                        445577889999***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.5E-446146IPR006780YABBY protein
SuperFamilySSF470952.36E-892147IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.9E-5100147IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MDLVSPSEHL CYVRCTYCNT VLAVGVPCKR LMDTVTVKCG HCNNLSFLSP RPPAVQPLSP  60
TDHPLGPFQG PCTDCRRNQP LPLVSPTSNE GSPRAPFVVK PPEKKHRLPS AYNRFMREEI  120
QRIKAAKPDI PHREAFSMAA KNWAKCDPRC SSTVSTSNSN PEPRVVAAPI PHQERANEQV  180
VESFDIFKQM ERSG
Functional Description ? help Back to Top
Source Description
UniProtRegulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN538847.1_FGP039
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1065530.0AB106553.1 Oryza sativa Japonica Group DROOPING LEAF mRNA for DL protein, complete cds.
GenBankAY4947130.0AY494713.1 Oryza sativa (japonica cultivar-group) drooping leaf (DL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630076.11e-141protein DROOPING LEAF isoform X2
SwissprotQ76EJ01e-143YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLA0A0D3FFG01e-140A0A0D3FFG0_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9Z3Y21e-140A0A0D9Z3Y2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CX851e-140A0A0E0CX85_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GJ001e-140A0A0E0GJ00_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NRK21e-140A0A0E0NRK2_ORYRU; Uncharacterized protein
TrEMBLA2XDY01e-140A2XDY0_ORYSI; Uncharacterized protein
STRINGOGLUM03G08460.11e-141(Oryza glumipatula)
STRINGORUFI03G08400.11e-141(Oryza rufipogon)
STRINGONIVA03G09180.11e-141(Oryza nivara)
STRINGOBART03G08320.11e-141(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59513657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.18e-54YABBY family protein