PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538757.1_FGP005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family YABBY
Protein Properties Length: 196aa    MW: 21703.6 Da    PI: 10.2069
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538757.1_FGP005genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY192.32.3e-591216622170
              YABBY  22 lavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee......lleelkveeenlksnvekeesastsvsseklsenede 107
                        + vsvP +s++++vtvrCGhCt+llsvnl+  ++  +a ++ +++  +e        ++ +  e  ++   ++++      ++ ++s ++++
  KN538757.1_FGP005  12 MQVSVPGNSMLNIVTVRCGHCTNLLSVNLRGLMHSAPALQDHHHHHLQEsnlsgcFRDQSGYPEFGFSAASSSSKLRLPPAAAAMVSYSQQN 103
                        78*******************************99998665444444444766666666667777777777777777777778888988888 PP

              YABBY 108 evprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                        +  ++    rPPekrqrvPsaynrfikeei+rika+nPdishreafs+aaknWah+P+ihfgl
  KN538757.1_FGP005 104 QQLEQALHARPPEKRQRVPSAYNRFIKEEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGL 166
                        888777789****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.7E-6012166IPR006780YABBY protein
SuperFamilySSF470952.62E-8111160IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.0E-5113160IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGNKRTKVIS CMQVSVPGNS MLNIVTVRCG HCTNLLSVNL RGLMHSAPAL QDHHHHHLQE  60
SNLSGCFRDQ SGYPEFGFSA ASSSSKLRLP PAAAAMVSYS QQNQQLEQAL HARPPEKRQR  120
VPSAYNRFIK EEIRRIKANN PDISHREAFS TAAKNWAHYP NIHFGLSPGH EGGKKLVDVD  180
PIPTAPSSKK IQGFYS
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN538757.1_FGP005
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2740180.0AB274018.1 Oryza sativa Japonica Group OsYABBY6 mRNA for OsYABBY6 protein, complete cds.
GenBankAK1049180.0AK104918.1 Oryza sativa Japonica Group cDNA clone:001-047-F07, full insert sequence.
GenBankCT8291390.0CT829139.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA051K22, full insert sequence.
GenBankFJ9401950.0FJ940195.1 Oryza sativa Japonica Group clone KCS385G10 YABBY protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618575.11e-134protein YABBY 6
SwissprotQ2QM171e-135YAB6_ORYSJ; Protein YABBY 6
TrEMBLA0A0E0BVE41e-133A0A0E0BVE4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0FE721e-133A0A0E0FE72_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0G0X71e-133A0A0E0G0X7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0RK591e-133A0A0E0RK59_ORYRU; Uncharacterized protein
TrEMBLB7EXC71e-133B7EXC7_ORYSJ; YABBY protein
TrEMBLB8BN251e-133B8BN25_ORYSI; Uncharacterized protein
TrEMBLI1R7Z41e-133I1R7Z4_ORYGL; Uncharacterized protein
STRINGOGLUM12G20870.11e-134(Oryza glumipatula)
STRINGORUFI12G21410.11e-134(Oryza rufipogon)
STRINGOS12T0621100-011e-134(Oryza sativa)
STRINGORGLA12G0165000.11e-134(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.21e-48YABBY family protein