PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538733.1_FGP021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 174aa    MW: 18782.4 Da    PI: 4.0186
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538733.1_FGP021genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.4e-073877443
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHH CS
           Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterq 43
                       ++++  eq+++Le+ F  +++++ ++++++A+ lgL+ rq
  KN538733.1_FGP021 38 KRRLALEQVRALERSFDTDNKLDPDRKARIARDLGLQPRQ 77
                       4567789******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.4E-63078IPR009057Homeodomain-like
CDDcd000864.71E-73777No hitNo description
PfamPF000467.1E-53877IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-74477IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEQKDEAEMA EAEDDDEEEV DEDMAGVHAA SCGLGEKKRR LALEQVRALE RSFDTDNKLD  60
PDRKARIARD LGLQPRQASP YSGAAFIGFG PSFLVDDASA ATVGCSSSLP ALESRWHGPY  120
SDDSCKGGVY GFTEEWLAAC SGEMAGNDAA GFFSDEHASN LNFGWCASVN EGWE
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN538733.1_FGP021
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1214891e-155AC121489.2 Oryza sativa Japonica Group chromosome 3 clone OJ1217B09, complete sequence.
GenBankAK0601191e-155AK060119.1 Oryza sativa Japonica Group cDNA clone:006-308-F01, full insert sequence.
GenBankAK1015221e-155AK101522.1 Oryza sativa Japonica Group cDNA clone:J033046N04, full insert sequence.
GenBankAK1056441e-155AK105644.1 Oryza sativa Japonica Group cDNA clone:001-200-F05, full insert sequence.
GenBankAP0149591e-155AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCT8310391e-155CT831039.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA023E12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628283.17e-64homeobox-leucine zipper protein HOX13 isoform X1
SwissprotA2XDD67e-65HOX13_ORYSI; Homeobox-leucine zipper protein HOX13
SwissprotQ10QP36e-65HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0D3FET46e-87A0A0D3FET4_9ORYZ; Uncharacterized protein
STRINGOGLUM03G06560.13e-63(Oryza glumipatula)
STRINGORUFI03G06390.13e-63(Oryza rufipogon)
STRINGOS03T0188900-013e-63(Oryza sativa)
STRINGONIVA02G06360.13e-63(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.21e-16homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]