PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AMDW01034480.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family FAR1
Protein Properties Length: 100aa    MW: 11306.6 Da    PI: 4.2159
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AMDW01034480.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR124.21.1e-0765100238
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCske 38 
                            fYn YA+ +GF +r+sk++++ + g   +++f+C +e
  AMDW01034480.1_FGP001  65 FYNLYARFTGFGIRRSKNRYK-DGGVKSMQEFCCIRE 100
                            9***************99987.889999******986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MEEEGWPEKG GEDHSGQPMD VVPLERIVVE GEEDSDLLPI SLSDPAILLP KIGQTFNEDS  60
DGYAFYNLYA RFTGFGIRRS KNRYKDGGVK SMQEFCCIRE
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1072261e-122AC107226.2 Oryza sativa Japonica Group chromosome 3 clone OSJNBa0081P02, complete sequence.
GenBankAP0149621e-122AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0149591e-122AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAP0072051e-122AP007205.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0048L03.
GenBankAP0047921e-122AP004792.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0505A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ10PQ21e-65Q10PQ2_ORYSJ; Transposon protein, putative, unclassified
STRINGLOC_Os03g12490.13e-65(Oryza sativa Japonica Group)
STRINGLOC_Os06g42520.12e-64(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1594035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28530.14e-07FAR1-related sequence 10