PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G22880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 632aa    MW: 71532.9 Da    PI: 6.5151
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G22880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.37.8e-912165852373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + lL++cA+a+++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+s+++ly+     ++ +++ +e l+++kl+  ++ + k++ 
  OGLUM11G22880.1 216 RMLLIQCAQAMATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGSGKHLYQ-----NQVRMSLVEYLKVYKLYMAACCFKKVAL 304
                      679********************************************************94.....33345599******************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + a  +I++av+g++r+Hi+D++i  Gl+Wp L++ L sR++gpp++RiT v+ p++g    +++e+ g+ L++ A+e++vpf+f++ va ++e
  OGLUM11G22880.1 305 MFAAMTIMQAVQGKKRLHIVDYGIRCGLHWPDLFRRLGSREDGPPEVRITIVDIPQPGfrPFQRIEAAGHCLSSCANEFRVPFRFQAAVAAKWE 398
                      *********************************************************9999**************************9999*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++  e+L+++p+E+l+Vn   +   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf  al yysalfd+l+a+ pres
  OGLUM11G22880.1 399 TVGAEDLHIEPDEVLVVNDLWSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGIINGSY-GASFLSRFRGALLYYSALFDMLDATTPRES 491
                      ******************************98776669************************9.789*************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        r  +E+ +lg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r L++ SaW
  OGLUM11G22880.1 492 GLRLALEQNVLGPYALNAIACEGADLVERPEKYRQWQARNHRAGMQQLKLRPDIVDTIREEVNKYYHKDFLLGEDGQWLLQGWMGRVLFAHSAW 585
                      ******************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.243189566IPR005202Transcription factor GRAS
PfamPF035142.7E-88216585IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENEAPP PSPVFFELPP TPLANSDGST DPSSLLDNQL LSYVSRMLME  60
DEMGSSAAVT NLQFVNRGST EEANNMLPSS EVVRAFLKGM EEASKLLPRN NSFRMLETVD  120
QVSSDGHCRG GKKKNHDRDE QQLEEELGRS SKLAAMTNAG TEEAGARELL DELMLHSHET  180
CIKDMEKLRI DMDNEADKTI NKKGKKGSSS KVVDLRMLLI QCAQAMATDN QQSAGELLKK  240
IKQHALATGD AMQRVAHYFA KGLEARLAGS GKHLYQNQVR MSLVEYLKVY KLYMAACCFK  300
KVALMFAAMT IMQAVQGKKR LHIVDYGIRC GLHWPDLFRR LGSREDGPPE VRITIVDIPQ  360
PGFRPFQRIE AAGHCLSSCA NEFRVPFRFQ AAVAAKWETV GAEDLHIEPD EVLVVNDLWS  420
FSALMDESVF CDGPNPRDVA LRNISKMQPD VFIQGIINGS YGASFLSRFR GALLYYSALF  480
DMLDATTPRE SGLRLALEQN VLGPYALNAI ACEGADLVER PEKYRQWQAR NHRAGMQQLK  540
LRPDIVDTIR EEVNKYYHKD FLLGEDGQWL LQGWMGRVLF AHSAWLPLKR EKVMMVKNHY  600
HKDFVIEEDQ WWLLQGWKGR ILFAHSTWVA HD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-312195858374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237242LKKIKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616386.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0BMH00.0A0A0E0BMH0_9ORYZ; Uncharacterized protein
STRINGORGLA11G0190500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-120GRAS family protein