PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G22870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 885aa    MW: 98726.6 Da    PI: 4.9083
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G22870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS286.38.8e-885068752373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + lL++cA+a ++++++ a +lL++++++   +gd+mqR+a+yf+++L+arla+ +++ly+     ++ +++ +e l+++kl+  ++ + k++ 
  OGLUM11G22870.1 506 RLLLIQCAQATATDNQQSAGELLKKIKQHTLATGDAMQRVAHYFAKGLEARLAGRGKHLYQ-----NQMRMSLVEYLKVYKLYMAACCFTKVAL 594
                      568***************************************************9999994.....33446699******************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + a  +I++av+g++r+Hi+D++   Gl+Wp Ll+ L sR++gpp++RiT v+  ++     +++ee g+ L++ A+e++vpf+f++++a ++e
  OGLUM11G22870.1 595 MFAAMTIMQAVQGKKRLHIVDYGPRCGLHWPDLLRRLGSREDGPPEVRITIVDILQPAfrPFQRIEEAGHCLSSCANEFRVPFRFQAVAAAKWE 688
                      *****************************************************99998999**************************9999*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++  e+L+++p+E+l+Vn  l+   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf   l yysalfd l+a+ pr+s
  OGLUM11G22870.1 689 TVGAEDLHIEPDEVLVVNDLLSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGITNDNY-GASFLSRFRAVLLYYSALFDILDATTPRDS 781
                      ******************************98776669**********************999.789*************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        r  +E+ llg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r L++ SaW
  OGLUM11G22870.1 782 GLRLALEQNLLGPYALNAIACEGADLVERPEKYKQWQARNHRAGMQQLKLRPDIVDTIRDEVNKYHHKDFLLGEDGQWLLQGWMGRILFAHSAW 875
                      ******************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.721479856IPR005202Transcription factor GRAS
PfamPF035143.1E-85506875IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 885 aa     Download sequence    Send to blast
MAAAPKPEEL VVAIEQPFSP SLFLDLPPTP HHDDDPNNVN DDLLLPFISR ILMEDDIDDK  60
FFYQFPDHPA LLQAQQSYAQ ILDAPATSSS SDDTTINNNT TNSTSVPDTL AMPDHDADTQ  120
SAPDDMEMLN IAFLKGREEA TKFLPTNNTL FSDLKAEPVL DIQPTFMFGP SDGGGGGRGR  180
KNRHAELEED DLETETSRSS KLMVPEQDDA AAADKIFDEI ILNGYQMIIK GIDELRVAMG  240
SQSQADKNGR RASRAKTAVV DLHTLLIHCA QAVATGDWRS ATELLKQIKQ NSMANPEDFF  300
WEALLKENEA PSPPPVFFDL PATPLSNSEG TDPSSLDNQL LSYVSRMLME DEMGSSAAIT  360
NLQCVNRGST EEANNMLPGS EVVRAFSKGM EEASKLLPRN NSFRTLETVD QVSSDGHCRG  420
RKKKNHDRDE QQLEEELGRS SKLAALTIAG TQEAGARELL DELMLHAHET CIKDMEKLRI  480
DMDNEAEKKI NKKDKKGSSS KVVDLRLLLI QCAQATATDN QQSAGELLKK IKQHTLATGD  540
AMQRVAHYFA KGLEARLAGR GKHLYQNQMR MSLVEYLKVY KLYMAACCFT KVALMFAAMT  600
IMQAVQGKKR LHIVDYGPRC GLHWPDLLRR LGSREDGPPE VRITIVDILQ PAFRPFQRIE  660
EAGHCLSSCA NEFRVPFRFQ AVAAAKWETV GAEDLHIEPD EVLVVNDLLS FSALMDESVF  720
CDGPNPRDVA LRNISKMQPD VFIQGITNDN YGASFLSRFR AVLLYYSALF DILDATTPRD  780
SGLRLALEQN LLGPYALNAI ACEGADLVER PEKYKQWQAR NHRAGMQQLK LRPDIVDTIR  840
DEVNKYHHKD FLLGEDGQWL LQGWMGRILF AHSAWVRQSQ DTSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-285098758374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1527532LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616387.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0BMG90.0A0A0E0BMG9_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g47920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-109GRAS family protein