PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G22840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 640aa    MW: 71842.1 Da    PI: 6.4784
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G22840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.61e-1062626362373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lLl+cA+av+++d + a++lL ++++++s  gd+ qRla++f+++L+arla+++s++y++l +++ts   +++ l+a++l+ e++ + k+++
  OGLUM11G22840.1 262 HNLLLHCAQAVATDDRRSAHELLRQIKQHSSAWGDAGQRLAHCFAQGLEARLAGTGSQVYQSLMSQRTS---VVDFLKAYRLYMEACCCKKVAF 352
                      689************************************************************999999...********************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      +  N++I++av+g +++Hi+D+++s+G+QWp Ll++La+R++gpp++RiTg++ p++g    + +eetg+rL+++A+elgvpf+f+ ++a++ e
  OGLUM11G22840.1 353 VFSNKTIYDAVAGRRKLHIVDYGLSYGFQWPGLLRELAARRGGPPEVRITGIDLPQPGfrPDQHIEETGRRLSRYADELGVPFKFHGIAATKKE 446
                      *********************************************************9*99***************************999*** PP

             GRAS 188 dleleeLrvkp.gEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                      +++leeL   + +E+++V +  +  +++des++ +s   +rdevL  +++++P+v+++   +  ++++ Fl+rf eal+yy+a fd l+a+++r
  OGLUM11G22840.1 447 SVRLEELGEAEeDEVVVVISLCHFRNVMDESLQEDSsrsPRDEVLGNIRRMRPDVFIHGIMNGAYGATYFLTRFREALYYYAAQFDLLDATVGR 540
                      *******77766******************9988777779****************************************************** PP

             GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                      es+er+ vEr ++gr++ nv+acegaer+er e +++W++r ++aG++++pl+ +++  +   +r  + + + v+e++ +l+  Wk+r L+++S
  OGLUM11G22840.1 541 ESHERMLVERDIFGRAALNVIACEGAERVERPEMYKQWQARNQRAGLRQLPLNPQVVRLVLDKVRDKYHKDFVVDEDQRWLLHRWKGRVLYALS 634
                      **************************************************************999999888*********************** PP

             GRAS 372 aW 373
                       W
  OGLUM11G22840.1 635 TW 636
                      ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.074235617IPR005202Transcription factor GRAS
PfamPF035143.6E-104262636IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MATTPEAEES LRFRWPAAEE EEFDNDMVLP YISRLLMEDD VHDHFFYQYP DHPALLRAQQ  60
PFAQILAASS SPSSAGGASS SSSSDAPPSR GFFDDEAATA KTTATFPTSA VHSVDHQYSG  120
GLDMVNMAFL KGMEEANKFL PTNTLLLSTD SSTTLQLQGQ GGHGMLGVGG AAHADADAAI  180
NSKKVNCRDD DLEAGTGRAA KLMAPEPERE EEGAREMFDE MMLQEHEICM KGVKQLSVKS  240
KSSSKKARGR RTVIHTEPVD LHNLLLHCAQ AVATDDRRSA HELLRQIKQH SSAWGDAGQR  300
LAHCFAQGLE ARLAGTGSQV YQSLMSQRTS VVDFLKAYRL YMEACCCKKV AFVFSNKTIY  360
DAVAGRRKLH IVDYGLSYGF QWPGLLRELA ARRGGPPEVR ITGIDLPQPG FRPDQHIEET  420
GRRLSRYADE LGVPFKFHGI AATKKESVRL EELGEAEEDE VVVVISLCHF RNVMDESLQE  480
DSSRSPRDEV LGNIRRMRPD VFIHGIMNGA YGATYFLTRF REALYYYAAQ FDLLDATVGR  540
ESHERMLVER DIFGRAALNV IACEGAERVE RPEMYKQWQA RNQRAGLRQL PLNPQVVRLV  600
LDKVRDKYHK DFVVDEDQRW LLHRWKGRVL YALSTWVAQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-392656368374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616926.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0E0BMG30.0A0A0E0BMG3_9ORYZ; Uncharacterized protein
STRINGORGLA11G0190400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-134GRAS family protein