PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G22830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 1004aa    MW: 112888 Da    PI: 5.395
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G22830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS349.55.3e-1073046822373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cA+av++gd + a++lL+++++++s +gd++qRla +f+e+L+arla+++s++yk+l ++ ts   +++ l+a+klf  ++ i k+s+
  OGLUM11G22830.1 304 HTLLIHCAQAVATGDRRSATELLKQIKQNSSARGDATQRLACCFAEGLEARLAGTGSQVYKSLVAKCTS---TVDFLKAYKLFAAACCIKKVSF 394
                      679**************************************************************9999...8********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      +  N++Il+av+g++++Hi+D+++s+G+QWp L++ L++R++gpp++RiTg++ p++g   ++++eetg+rL++ A+++gvpf+f++ +a ++e
  OGLUM11G22830.1 395 IFSNKTILDAVAGKRKLHIVDYGLSYGFQWPGLFKCLSEREGGPPEVRITGIDVPQPGfrPADQIEETGRRLSNCARQFGVPFRFQA-IAAKWE 487
                      *********************************************************9*****************************.799*** PP

             GRAS 188 dleleeLrvkp.......gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                      +++ e+L++++       +E+l+Vn+ + l  l desv ++s  +rd vL+ +++++P+v+v +  +  ++++ Fl+rf e+l +ys+ fd+l+
  OGLUM11G22830.1 488 TVRREDLHLDReeeeeeeEEVLVVNCLHFLNALQDESVVVDSpsPRDMVLNNIRDMRPHVFVQCVVNGAYGAPFFLTRFRETLFFYSSQFDMLD 581
                      *******9999999999999*****************98888779************************************************* PP

             GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                      a++pr+++er  +Er +lgr++ nv+acega+r+ r et+++W  r ++aG++++pl+ ++++ ++  ++k + + + ++ ++++l++gWk+r 
  OGLUM11G22830.1 582 ATIPRDNDERLLIERDILGRWALNVIACEGADRVDRPETYKQWLVRNHRAGLTQLPLQPQVVELVRDKVKKLYHKDFVIDVDHNWLLQGWKGRI 675
                      *************************************************************************888****************** PP

             GRAS 367 LvsvSaW 373
                      L+++S W
  OGLUM11G22830.1 676 LYAMSTW 682
                      ******* PP

2GRAS2683.2e-82683100051367
             GRAS   51 arlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppsl 142 
                       arla+++s++yk+l +++ts   +++ l+a+klf  ++ + k+s +  N++I++av+g++++Hi+D+++s+G+QWpaL+  L +R++gpp++
  OGLUM11G22830.1  683 ARLAGTGSQVYKSLVAKRTS---TVDFLKAYKLFTAACCVKKVSVIFSNKTIYNAVAGKRKLHIVDYGLSYGFQWPALFFLLGTREGGPPEV 771 
                       589999********999999...8******************************************************************** PP

             GRAS  143 RiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsles..erdevLk 229 
                       R+T ++ p++g   ++++eetg+rL++ A+++gvpf+f++ +a ++e+++ e+L++++ +E+l+Vn+ + l +l desv ++s  +rd vL+
  OGLUM11G22830.1  772 RMTCIDVPQPGfrPADQIEETGRRLSNCARQFGVPFKFRT-IAAKWETVRREDLHLEEeEEVLVVNCLHGLNTLQDESVVVDSpsPRDVVLN 862 
                       **********9*****************************.799*************9899*****************98888779****** PP

             GRAS  230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321 
                        + +++P+v+v +  +  ++++ F++rf eal +ysa fd+l+a++pr++++r  +Er +lgr + nv+acega+r+ r et+++W+ r ++
  OGLUM11G22830.1  863 NIGDMRPHVFVQCVVNGAYGAPFFVTRFREALFFYSAHFDMLDATIPRDNDDRLLIERDMLGRCALNVIACEGADRVDRPETYKQWQVRNHR 954 
                       ******************************************************************************************** PP

             GRAS  322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367 
                       aG++++pl++++++ ++  ++ ++ + + ++ ++++l++gWk+r L
  OGLUM11G22830.1  955 AGLRQLPLETEVVELVREKVKSHYHKDFVIDVDHNWLLQGWKGRIL 1000
                       ************************888****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.018277663IPR005202Transcription factor GRAS
PfamPF035141.8E-104304682IPR005202Transcription factor GRAS
PROSITE profilePS5098543.568683987IPR005202Transcription factor GRAS
PfamPF035141.1E-796831000IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 1004 aa     Download sequence    Send to blast
MAAAAPQLEE LVDLEPFSPS LFLDLPPTPH GDDPNDDDLI LPFISRMLME DDIDDKFFYQ  60
FPDHPALLHA QQPYAQILDA PSDDTTTNSS DDSASATTNN TTNSAAAANA SWPYDPIELS  120
QLLQSPPHPV SDNHDADVGD TRSAPEDDKD LKLLFSAADN MEMLNMAFLK GREEANKLVP  180
TNNTLFAGFD GASLLKTEPA VDEPTLMFGR SGGSGRGRKN RHGEEDDLEA ETGRSSKLMV  240
PPQEDTAAAS EMFDEIIFNG YEVIMKGMEE LRVAMDSEAE KKARNGGGAG RRAARAKAAV  300
VDLHTLLIHC AQAVATGDRR SATELLKQIK QNSSARGDAT QRLACCFAEG LEARLAGTGS  360
QVYKSLVAKC TSTVDFLKAY KLFAAACCIK KVSFIFSNKT ILDAVAGKRK LHIVDYGLSY  420
GFQWPGLFKC LSEREGGPPE VRITGIDVPQ PGFRPADQIE ETGRRLSNCA RQFGVPFRFQ  480
AIAAKWETVR REDLHLDREE EEEEEEEVLV VNCLHFLNAL QDESVVVDSP SPRDMVLNNI  540
RDMRPHVFVQ CVVNGAYGAP FFLTRFRETL FFYSSQFDML DATIPRDNDE RLLIERDILG  600
RWALNVIACE GADRVDRPET YKQWLVRNHR AGLTQLPLQP QVVELVRDKV KKLYHKDFVI  660
DVDHNWLLQG WKGRILYAMS TWARLAGTGS QVYKSLVAKR TSTVDFLKAY KLFTAACCVK  720
KVSVIFSNKT IYNAVAGKRK LHIVDYGLSY GFQWPALFFL LGTREGGPPE VRMTCIDVPQ  780
PGFRPADQIE ETGRRLSNCA RQFGVPFKFR TIAAKWETVR REDLHLEEEE EVLVVNCLHG  840
LNTLQDESVV VDSPSPRDVV LNNIGDMRPH VFVQCVVNGA YGAPFFVTRF REALFFYSAH  900
FDMLDATIPR DNDDRLLIER DMLGRCALNV IACEGADRVD RPETYKQWQV RNHRAGLRQL  960
PLETEVVELV REKVKSHYHK DFVIDVDHNW LLQGWKGRIL GRNW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3630710008374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617900.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809331e-146SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0E0BMG20.0A0A0E0BMG2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA035741-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-133GRAS family protein