PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G21110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 386aa    MW: 42552.8 Da    PI: 6.7161
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G21110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.46e-211053245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     + en+s r+vt+skRr gilKKA+ELS+LCd+   +++fs++gk
  OGLUM11G21110.1 10 KLENSSGRHVTYSKRRSGILKKAKELSILCDIPLILLMFSPNGK 53
                     679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-27160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.899153IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.03E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-16323IPR002100Transcription factor, MADS-box
PfamPF003195.8E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRHVT YSKRRSGILK KAKELSILCD IPLILLMFSP NGKPTICVGD  60
HSSIEDVITK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEELSSH  120
LGALQCQMAD VEKRLSYWSD PEKVDNIDHI RAMEQSLKES LNRIRIHKEN FAKQHLMSLQ  180
CAAAQFQNDM QLPLGLTGDP NTSSWFHGGG SAEAQQPMML PEDPSLLHQR DIGCSASTSL  240
QSYPGYFSMG KQSTDNAGGG EQHHHAAVQQ QQQPEFSQAD CLTSLQLGAQ FPYPSAFDNA  300
GLLSDRLFDN AAAAAAAAMD FGGHYDLPRP GDEASFQNWA SAACGATMYD HQQQQQQQQQ  360
PAQLPAAATV EAPSFNHPSP HRQLMI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565050.0FM956505.1 Oryza sativa Japonica Group mRNA for MADS68 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618002.10.0agamous-like MADS-box protein AGL65 isoform X1
TrEMBLA0A0E0BLV10.0A0A0E0BLV1_9ORYZ; Uncharacterized protein
STRINGOGLUM11G21110.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-85AGAMOUS-like 30