PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G08660.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 901aa    MW: 99502.5 Da    PI: 5.6001
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G08660.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.62.8e-29547597252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  OGLUM11G08660.3 547 EKSVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKIKKV 597
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.348536617IPR003035RWP-RK domain
PfamPF020424.0E-26550597IPR003035RWP-RK domain
SuperFamilySSF542776.54E-24794889No hitNo description
Gene3DG3DSA:3.10.20.2402.4E-24800882No hitNo description
PROSITE profilePS5174526.147803885IPR000270PB1 domain
PfamPF005645.7E-19803884IPR000270PB1 domain
SMARTSM006661.4E-25803885IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 901 aa     Download sequence    Send to blast
MDGGGTPDGD PVPDMDMLML SSALDGLDSY TDLVAGSSVA DSIFSALTCF PPSQERLLHV  60
STAVGSSSRQ DDADVSITEE GTTRTRSDRA AGLASGEPVA VGIGSVPKPF DGVTLTERML  120
RALAMLKEAS GGEAILVQVW MPVRNGEQHV LTTSDQPFLL DQKLTGYREV SRQFTFSAEE  180
GPGLFPGLPG RVFMSGMPEW TSNVMYYHGS EYLRVDYATR HEVRGSLAMP VFNSSGGSCC  240
AVLEVVMTRE KDNFCLEMVN VSNALQGNLD QFAYLDQLEV LSYSRDQKLA LMEIFDVLQA  300
VCQAHLLPLA LAWIPVCSKR DVLVSIEYGA KFGKRNKEVL CIEESACYVN DTRVRDFVQV  360
CAEHPLEKGQ GVAGNAYLSN NPFFSSDVKD YDMHAYPLVN HARKFGLHAA VAIRLRSTYT  420
KNDDYVLEFF LPVLCKGGEE QQLLLDSISA TMRKVCKSLR TVSDAELKED VTRKPSNENR  480
SGTRCPSPVN LIYSGREIDV SNETKTNTPL EYQIEGIDEQ LSDTKSTNKL IKCSNASDGE  540
KRRSSTEKSV SLSVLQQYFS GSLKDAAKSI GVCPTTLKRI CRQHGISRWP SRKIKKVNRS  600
LKKIQNVISS VHGVEGVLKY DPSTGCLISS VSPSIEPVLM NVEHKGSDPL PIESELPHLN  660
FEPDCDAYRR EHAGQDVLHK LQNKQNGEIN FDMDDGELFR NSHSTRTLSG AFCEDMSNGL  720
YVAREMTCVA KTGTRTERLE HKPSSRDSFS APQEYRMESE TDKSNKNSKQ SLPSSSSMTD  780
CSTSSGETFK SIKSQSANES NTTVVVKASY KNDTIRFKLL PSMKYEQLLE EIAKRLKLSV  840
GVFQIKYKDD EGDWVILASD ADLQECLEIL DTTRLHILKL QVQDVVCPIG SSSGSCSMLR  900
P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0648590.0AK064859.1 Oryza sativa Japonica Group cDNA clone:J013000H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616880.10.0PREDICTED: protein NLP2-like isoform X1
RefseqXP_015616881.10.0PREDICTED: protein NLP2-like isoform X1
TrEMBLA0A0E0BHI90.0A0A0E0BHI9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034185-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein