PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM11G08660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 864aa    MW: 95298.9 Da    PI: 6.0243
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM11G08660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.7e-29532582252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  OGLUM11G08660.1 532 EKSVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKIKKV 582
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.348521602IPR003035RWP-RK domain
PfamPF020423.8E-26535582IPR003035RWP-RK domain
SuperFamilySSF542776.21E-24751846No hitNo description
Gene3DG3DSA:3.10.20.2402.2E-24757839No hitNo description
PROSITE profilePS5174526.147760842IPR000270PB1 domain
SMARTSM006661.4E-25760842IPR000270PB1 domain
PfamPF005645.4E-19760841IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 864 aa     Download sequence    Send to blast
MDGGGTPDGD PVPDMDMLML SSALDGLDSY TDLVAGSSVA DSIFSALTCF PPSQERLLHV  60
STAVGSSSRQ DDADVSITEE GTTRTRSDRA AGLASGEPVA VGIGSVPKPF DGVTLTERML  120
RALAMLKEAS GGEAILVQVW MPVRNGEQHV LTTSDQPFLL DQKLTGYREV SRQFTFSAEE  180
GPGLFPGLPG RVFMSGMPEW TSNVMYYHGS EYLRVDYATR HEVRGSLAMP VFNSSGGSCC  240
AVLEVVMTRE KDNFCLEMVN VSNALQSYSR DQKLALMEIF DVLQAVCQAH LLPLALAWIP  300
VCSKRDVLVS IEYGAKFGKR NKEVLCIEES ACYVNDTRVR DFVQVCAEHP LEKGQGVAGN  360
AYLSNNPFFS SDVKDYDMHA YPLVNHARKF GLHAAVAIRL RSTYTKNDDY VLEFFLPVLC  420
KGGEEQQLLL DSISATMRKV CKSLRTVSDA ELKEDVTRKP SNENRSGTRC PSPVNLIYSG  480
REIDVSNETK TNTPLEYQIE GIDEQLSDTK STNKLIKCSN ASDGEKRRSS TEKSVSLSVL  540
QQYFSGSLKD AAKSIGVCPT TLKRICRQHG ISRWPSRKIK KVNRSLKKIQ NVISSVHGVE  600
GVLKYDPSTG CLISSVSPSI EPVLMNVEHK GQDVLHKLQN KQNGEINFDM DDGELFRNSH  660
STRTLSGAFC EDMSNGLYVA REMTCVAKTG TRTERLEHKP SSRDSFSAPQ EYRMESETDK  720
SNKNSKQSLP SSSSMTDCST SSGETFKSIK SQSANESNTT VVVKASYKND TIRFKLLPSM  780
KYEQLLEEIA KRLKLSVGVF QIKYKDDEGD WVILASDADL QECLEILDTT RLHILKLQVQ  840
DVVCPIGSSS ERCGFGSTVI DLFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0648590.0AK064859.1 Oryza sativa Japonica Group cDNA clone:J013000H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616882.10.0PREDICTED: protein NLP2-like isoform X2
TrEMBLA0A0E0BHI70.0A0A0E0BHI7_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g16290.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-175Nin-like family protein