PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G07890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 303aa    MW: 32707.8 Da    PI: 4.8565
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G07890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.4e-1963116356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++ +eq+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  OGLUM10G07890.1  63 KKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 116
                      4557899**********************************************9 PP

2HD-ZIP_I/II125.82e-4062154193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl++eqv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal+ e ++L++++++L++e+++
  OGLUM10G07890.1  62 EKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFAALRSRHDALRLECDALRRDKDALAAEIAD 154
                      69**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-1941119IPR009057Homeodomain-like
SuperFamilySSF466892.18E-1855120IPR009057Homeodomain-like
PROSITE profilePS5007116.55258118IPR001356Homeobox domain
SMARTSM003891.6E-1861122IPR001356Homeobox domain
PfamPF000463.7E-1663116IPR001356Homeobox domain
CDDcd000861.29E-1663119No hitNo description
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PfamPF021834.2E-13118158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MKRPSCRGSS MAIIHDTSDQ QEDNMRSYMD GGGAAAYEEE EEEVEDDDGG GGGGGGGGGL  60
GEKKRRLAAE QVRALERSFE ADNKLDPERK ARIARDLRLH PRQVAVWFQN RRARWKTKQI  120
ERDFAALRSR HDALRLECDA LRRDKDALAA EIADLRDRVD GQMSVKLEAV AMDEHQPPPP  180
PPPPPLAYNN KVVDGSTDSD SSAVFNEEAS PYSGAAIDHH HHQTPASYDT AGFTSFFAPS  240
TTLTSSLSFP SMFHASSHFD GHQELLVGGG GAGAVADADL GGAGFFAGDE HAGGLSWYGA  300
EGW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110118RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8376740.0CT837674.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA120C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613231.11e-172homeobox-leucine zipper protein HOX8
SwissprotQ338Z71e-173HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A0E0B9T60.0A0A0E0B9T6_9ORYZ; Uncharacterized protein
STRINGOGLUM10G07890.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.17e-33homeobox protein 16
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]