PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G19240.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 841aa    MW: 92487.8 Da    PI: 6.622
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G19240.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.5e-29527577252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  OGLUM09G19240.3 527 EKTVSLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGINRWPSRKIKKV 577
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.734516597IPR003035RWP-RK domain
PfamPF020429.7E-26529577IPR003035RWP-RK domain
SuperFamilySSF542771.6E-20734830No hitNo description
SMARTSM006668.0E-18744827IPR000270PB1 domain
PROSITE profilePS5174518.398744827IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.6E-24744825No hitNo description
CDDcd064073.31E-43745825No hitNo description
PfamPF005644.0E-15745825IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MEEGDPQPSI SLARTPSEGA AAAVDLDLLE QLLSADNAWL EVAANTSRSP NFFATPSNCL  60
TDASVATTTP ANSWWIQPSG ASTSVRERFD QALAYIRETQ SDANVLVQLW VPVKGNDGQL  120
VLTTSGQPFT LDQRSNSLIQ FREVSTKYQF SADVASGSSP GLPGRVFIGR LPEWSPDVRY  180
FTSYEYPRIS HAQYLDVHGT MGLPVFERGN SSCLGVIELI MTKQKLNFTS ELNTICSALQ  240
AVNLTSTEVS SIPRTKLNSA SYKDALPEIL EVLRAACITH KLPLAQTWVT CAQQGKRGSR  300
HSDENYKYCI STIDAACYVN EPQMQSFHEA CSEHHLLQGQ GVAGKAFTTN QPCFLPDIGS  360
STKLEYPLSH HAKIFNLKGA VAIRLRCTRT GIADFVLEFF LPTDCEVLEE QKAVLDSLSG  420
TMRSVCQTLR VVTDKEMEDE AMREMNELNS FSPQGKNKVE ELSFGDNTRE DREETSWTTL  480
VGTSQKGSDL AELHTHGMLS HGGQGSSQAG DQTSKEGSKV KRRTKTEKTV SLQVLRQYFA  540
GSLKDAAKSL GVCPTTLKRI CRQHGINRWP SRKIKKVDHS LRKLQQIIDS VHGAETAFQL  600
NTLYKDLTNT SVSSDNNLSG SVTVPLANQN NLDFEKHQHH RLSSNIPSTS LSHSSCSQSS  660
DSSPSCSGGA TKHSPQVGAD QVRLGCLPQH SPVQTLHTEA ASINEHFSGQ EAPIDLLQDV  720
AEKANGEQHM SQSPSSPKQT ANVGMRVKVT FGSEKVRFRL KPECDFQELK QEISKRLSIV  780
DMNSLIVKYL DDDSEWVLMT CDADLHECFH VYKLADIQTI KISVHLAASP TRITIGHTGF  840
S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056790.0AP005679.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1210_A07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612116.10.0PREDICTED: protein NLP1-like isoform X2
RefseqXP_015612117.10.0PREDICTED: protein NLP1-like isoform X2
TrEMBLA0A0E0B6570.0A0A0E0B657_9ORYZ; Uncharacterized protein
STRINGLOC_Os09g37710.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein