PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G19240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 888aa    MW: 97379.5 Da    PI: 6.6782
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G19240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.65.9e-29574624252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  OGLUM09G19240.1 574 EKTVSLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGINRWPSRKIKKV 624
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.734563644IPR003035RWP-RK domain
PfamPF020421.0E-25576624IPR003035RWP-RK domain
SuperFamilySSF542771.7E-20781877No hitNo description
SMARTSM006668.0E-18791874IPR000270PB1 domain
PROSITE profilePS5174518.398791874IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.9E-24791872No hitNo description
CDDcd064072.42E-43792872No hitNo description
PfamPF005644.3E-15792872IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 888 aa     Download sequence    Send to blast
MMCSSLLPTP CNPNAGKSST KFIPGLPVSC TPLAQDVQRN SEGNLTCMEE GDPQPSISLA  60
RTPSEGAAAA VDLDLLEQLL SADNAWLEVA ANTSRSPNFF ATPSNCLTDA SVATTTPANS  120
WWIQPSGAST SVRERFDQAL AYIRETQSDA NVLVQLWVPV KGNDGQLVLT TSGQPFTLDQ  180
RSNSLIQFRE VSTKYQFSAD VASGSSPGLP GRVFIGRLPE WSPDVRYFTS YEYPRISHAQ  240
YLDVHGTMGL PVFERGNSSC LGVIELIMTK QKLNFTSELN TICSALQAVN LTSTEVSSIP  300
RTKLNSASYK DALPEILEVL RAACITHKLP LAQTWVTCAQ QGKRGSRHSD ENYKYCISTI  360
DAACYVNEPQ MQSFHEACSE HHLLQGQGVA GKAFTTNQPC FLPDIGSSTK LEYPLSHHAK  420
IFNLKGAVAI RLRCTRTGIA DFVLEFFLPT DCEVLEEQKA VLDSLSGTMR SVCQTLRVVT  480
DKEMEDEAMR EMNELNSFSP QGKNKVEELS FGDNTREDRE ETSWTTLVGT SQKGSDLAEL  540
HTHGMLSHGG QGSSQAGDQT SKEGSKVKRR TKTEKTVSLQ VLRQYFAGSL KDAAKSLGVC  600
PTTLKRICRQ HGINRWPSRK IKKVDHSLRK LQQIIDSVHG AETAFQLNTL YKDLTNTSVS  660
SDNNLSGSVT VPLANQNNLD FEKHQHHRLS SNIPSTSLSH SSCSQSSDSS PSCSGGATKH  720
SPQVGADQVR LGCLPQHSPV QTLHTEAASI NEHFSGQEAP IDLLQDVAEK ANGEQHMSQS  780
PSSPKQTANV GMRVKVTFGS EKVRFRLKPE CDFQELKQEI SKRLSIVDMN SLIVKYLDDD  840
SEWVLMTCDA DLHECFHVYK LADIQTIKIS VHLAASPTRI TIGHTGFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056790.0AP005679.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1210_A07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612115.10.0PREDICTED: protein NLP1-like isoform X1
TrEMBLA0A0E0B6550.0A0A0E0B655_9ORYZ; Uncharacterized protein
STRINGBGIOSGA031219-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein