PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G04350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 782aa    MW: 84432.1 Da    PI: 6.4982
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G04350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25e-16459497240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  OGLUM07G04350.1 459 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 497
                      589**********************************96 PP

2TCR50.93.1e-16545584140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  OGLUM07G04350.1 545 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCEGCKNTF 584
                      589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17458499IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.33459585IPR005172CRC domain
PfamPF036388.8E-12461496IPR005172CRC domain
SMARTSM011141.7E-17545586IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.1E-12547583IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MDTPDLQDSP LFSFINSLSP IEPLKSAYSA SSIQAYQSLN ITSISSIFTS PHDNAQKESK  60
LSKSSFAEFS ESEVCADESD KNKPSKSSNA VRLFACTSTL TQATHKITSS VSEGTVGPPE  120
GSNDLPQPGQ FDSGSPDHNT TPCHGVRSDL KQGKCRKLQA FQTAKTNTSE KRKCLFSTEV  180
QLMDGCQPEK LNDEILGCDW DDLISATSGE LIAYDEDHKG VQLAVSNAES CGFLLSKLTG  240
DGDISDRTHP SSSTQTYYRE LLMDEDQTEN AQLVPDGEKN ISTEEIQDNL YEANGSIPTG  300
YKVETQQQRG MRRRCLVFEA AGYSNRIVQK ESVMDLSVST CKGKSPVQNH SNPGKTPSPR  360
VLRGIGLHLN ALALTSKDKM ICQDPMSSLV PSSATQQEAH GKMLSAGENF IHPGGELLEL  420
QMDDDCSAGV FLGNDHDSSQ SNSPQKKRRK SDNGDDGEAC KRCSCKKSKC LKLYCECFAA  480
GVYCSEPCSC QGCLNKPIHE EIVLSTRKQI EFRNPLAFAP KVIRMSDAGQ DITGEDPNNT  540
PASARHKRGC NCKKSSCLKK YCECYQGGVG CSSNCRCEGC KNTFGKRDAA VSTEAEEMKQ  600
GGEEAENCGK EKENDLQKAN AQSEDHPFLE LVPITPPFDV SSSLLKPPNF SSAKPPRPTK  660
ARSNSSRSSS KAPGAVHSQK FSKIANSGLN EEMPDILRDD ASPGNCVKTS SPNGKRVSPP  720
HNALSVSPSR KGGRKLILKS IPSFPSLIGD ASSGSSMNSS ESAFNAASPL ALDVRLYTSL  780
LT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1646158212120Protein lin-54 homolog
5fd3_B1e-1646158212120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1445449KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658970.0AK065897.1 Oryza sativa Japonica Group cDNA clone:J013048O08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646690.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A0E0AGE80.0A0A0E0AGE8_9ORYZ; Uncharacterized protein
STRINGOGLUM07G04350.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-84TESMIN/TSO1-like CXC 2