PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G01740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 357aa    MW: 38734.5 Da    PI: 7.0002
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G01740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox309.1e-102833182055
                      HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  OGLUM07G01740.1 283 YKWPYPSETEKIALAESTGLDQKQINNWFINQRKRH 318
                      4679*****************************885 PP

2ELK35.71.9e-12238259122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLl+KYsgyL+sL+qEFs
  OGLUM07G01740.1 238 ELKFQLLKKYSGYLSSLRQEFS 259
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.8E-2388132IPR005540KNOX1
PfamPF037904.1E-2290130IPR005540KNOX1
SMARTSM012565.4E-30135186IPR005541KNOX2
PfamPF037917.9E-24140184IPR005541KNOX2
PfamPF037892.3E-9238259IPR005539ELK domain
SMARTSM011885.7E-7238259IPR005539ELK domain
PROSITE profilePS5121311.401238258IPR005539ELK domain
PROSITE profilePS5007112.892258321IPR001356Homeobox domain
SuperFamilySSF466891.28E-19259332IPR009057Homeodomain-like
SMARTSM003894.4E-13260325IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-28263322IPR009057Homeodomain-like
CDDcd000863.78E-12270322No hitNo description
PfamPF059201.0E-16278317IPR008422Homeobox KN domain
PROSITE patternPS000270296319IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MDQSFGNLGG GGAGGSGKAA ASSFLQLPLS TAAAATAYYG TPLALHQAAA AAGPSQYHGH  60
GHPHHGGGHH HSKHGGAGGG EISAAEAESI KAKIMAHPQY SALLAAYLDC QKVGAPPEVL  120
ERLTATAAKL DARPPGRHDA RDPELDQFME AYCNMLAKYR EELTRPIDEA MEFLKRVESQ  180
LDTIAGGAHG GSGGGAGSAR LLLADGKSEC VGSSEDDMDP SGRENEPPEI DPRAEDKELK  240
FQLLKKYSGY LSSLRQEFSK KKKKGKLPKE ARQKLLHWWE LHYKWPYPSE TEKIALAEST  300
GLDQKQINNW FINQRKRHWK PSEDMPFVMM EGFHPQNAAA LYMDGPFMAD GMYRLGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0501810.0AF050181.1 Oryza sativa strain Indica IR58 KNOX class homeodomain protein (Oskn3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646117.10.0PREDICTED: homeobox protein knotted-1-like 12
SwissprotO650340.0KNOSC_ORYSI; Homeobox protein knotted-1-like 12
SwissprotO804160.0KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
TrEMBLI1Q7T10.0I1Q7T1_ORYGL; Uncharacterized protein
TrEMBLA0A0E0AFG90.0A0A0E0AFG9_9ORYZ; Uncharacterized protein
STRINGORGLA07G0017300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-103KNOTTED-like from Arabidopsis thaliana