PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G23980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 283aa    MW: 30632.3 Da    PI: 6.8645
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G23980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-072262592154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp++e++++L +++gL+ +q+ +WF N+R +
  OGLUM06G23980.1 226 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 259
                      569*****************************87 PP

2ELK29.51.6e-10180201122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELKh+L+++Y+++L+++++E++
  OGLUM06G23980.1 180 ELKHELKQGYREKLVDIREEIL 201
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-194589IPR005540KNOX1
PfamPF037901.3E-164885IPR005540KNOX1
SMARTSM011880.0014180201IPR005539ELK domain
PROSITE profilePS5121310.196180200IPR005539ELK domain
PfamPF037892.5E-6180201IPR005539ELK domain
PROSITE profilePS5007111.596200263IPR001356Homeobox domain
SuperFamilySSF466891.2E-15202267IPR009057Homeodomain-like
SMARTSM003893.3E-10202267IPR001356Homeobox domain
CDDcd000862.01E-11203264No hitNo description
Gene3DG3DSA:1.10.10.602.0E-24207264IPR009057Homeodomain-like
PfamPF059202.9E-18220259IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MAFHYQDHAL AMDAAAAAAE TGGHHHPGFV GAGGVVGGGG GGGWEREKAA IAAHPLYERL  60
LEAHVACLRV ATPVDQLPRI DAQIAARPPP LAAASAAAAA DPLCIAPLFV QGTTTATFVT  120
LTAGASPGEG SGATMSDDED NQVDSESNMF DGNDGSDGMG FGPLMLTEGE RSLVERVRQE  180
LKHELKQGYR EKLVDIREEI LRKRRAGKLP GDTASTLKAW WQAHSKWPYP TEEDKARLVQ  240
ETGLQLKQIN NWFINQRKRN WHSNPASSSS DKSKRKRYRV VDF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256276RKRNWHSNPASSSSDKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0618180.0AB061818.1 Oryza sativa Japonica Group HOS59 mRNA for KNOX family class 2 homeodomain protein, complete cds.
GenBankAB0076280.0AB007628.2 Oryza sativa Japonica Group HOS59 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644389.11e-135PREDICTED: homeobox protein knotted-1-like 11 isoform X1
RefseqXP_015644390.11e-136PREDICTED: homeobox protein knotted-1-like 11 isoform X2
SwissprotQ94LW41e-137KNOSB_ORYSJ; Homeobox protein knotted-1-like 11
TrEMBLA0A0E0ACJ20.0A0A0E0ACJ2_9ORYZ; Uncharacterized protein
STRINGORGLA06G0189900.11e-136(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.22e-84KNOTTED1-like homeobox gene 3