PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G22660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 224aa    MW: 24550.7 Da    PI: 5.9801
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G22660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.8e-1168117251
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      ++l + rr   NReA r++R++Kka  + Lee+vk+L a N++L k+l+ 
  OGLUM05G22660.1  68 EDLTKIRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLKRLQG 117
                      678899999************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.1E-1667135No hitNo description
SMARTSM003384.4E-1267134IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.94469116IPR004827Basic-leucine zipper domain
PfamPF077161.9E-1369124IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.69E-872117No hitNo description
CDDcd146863.01E-1372125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MDDVPSQLLF SHPEVPDSFD DFLNNITTCT HTHTCNPPGP SATMHTHTCL HTHTQVFASG  60
SGEDDIKEDL TKIRRPLGNR EAVRKYREKK KAHAAFLEEE VKKLRAANQQ LLKRLQGHAA  120
LEAEVIRLRS ILLDVRGKID MEIGTFPYQK PCSVGSVACT DPGLCFNGNS EIGGVWEECS  180
RPAGADRMID KDGSMSQEID IPGPVHSISM DVVGSLVTSA SLSE
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1121600.0AC112160.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1579_G03, complete sequence.
GenBankAK0722810.0AK072281.1 Oryza sativa Japonica Group cDNA clone:J023018E07, full insert sequence.
GenBankAK1049860.0AK104986.1 Oryza sativa Japonica Group cDNA clone:002-110-E11, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638714.11e-166basic leucine zipper 23
RefseqXP_025881179.11e-166basic leucine zipper 23
RefseqXP_025881180.11e-166basic leucine zipper 23
RefseqXP_025881181.11e-166basic leucine zipper 23
RefseqXP_025881182.11e-166basic leucine zipper 23
SwissprotQ8GTS23e-57BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0E0A1451e-168A0A0E0A145_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g41540.11e-166(Oryza sativa Japonica Group)
STRINGORGLA05G0186200.11e-166(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.16e-40bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]