PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G18920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 194aa    MW: 20814.3 Da    PI: 10.2297
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G18920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.86.4e-15113164354
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                      +++r++r++kNRe+A rsR+RK+a+i+eLe  v+eLe+e  +L  e ee ++
  OGLUM05G18920.1 113 AIQRQKRMIKNRESAARSRERKQAYIAELEAQVAELEEEHAQLLREQEEKNQ 164
                      789**************************************99977666544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-9111176IPR004827Basic-leucine zipper domain
PfamPF001707.2E-13112164IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.841113161IPR004827Basic-leucine zipper domain
CDDcd147078.17E-17115161No hitNo description
SuperFamilySSF579593.66E-11116162No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-13116163No hitNo description
PROSITE patternPS000360118133IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MASSRAAGPP VAEVAARRTA EEVWKEISSS GGLSAPAPAP AAGAAGRGGG PEMTLEDFLA  60
REDDPRATAV EGNMVVGFPN GTEGVGTAGG GRGGGGGGRG RKRTLMDPAD RAAIQRQKRM  120
IKNRESAARS RERKQAYIAE LEAQVAELEE EHAQLLREQE EKNQKRLKEI KEQAVAVVIR  180
KKTQDLRRTN SMEW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18997GGRGGGGGG
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8341090.0CT834109.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA060C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639395.11e-100bZIP transcription factor 12-like
SwissprotQ0JHF16e-57BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A0D9ZZQ81e-133A0A0D9ZZQ8_9ORYZ; Uncharacterized protein
STRINGOGLUM05G18920.11e-134(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-13bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]