PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G24370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 212aa    MW: 21545 Da    PI: 6.9612
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G24370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP46.51.4e-1465983568
              TCP 35 LqdeLGfdkdsktieWLlqqakpaikeltgtsss 68
                     L++eLG++++++t++WLlqqa+pai  +tgt+ s
  OGLUM04G24370.1 65 LTRELGHKSNGETVQWLLQQAEPAIVTATGTGVS 98
                     8******************************433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.6E-106598IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MWGPPEDASA RREGEDPLSA AADIGGGGGG GGEEDAGARA EVELEQGPAH QGGRPGTTNP  60
DAGVLTRELG HKSNGETVQW LLQQAEPAIV TATGTGVSVD IPRALPPFPK LRPLQVAPPP  120
PPHVGCRRRA ARRVRGVRRC HIGFVTMFAG HAAAAMPGLE LGLSQDGHIG VLSARSLSQF  180
YHQVGGADAA DQLPHPAASS PTPSAAAGGR GG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126101e-176CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624510.23e-41LOW QUALITY PROTEIN: transcription factor TCP20
TrEMBLA0A0D9ZQA81e-146A0A0D9ZQA8_9ORYZ; Uncharacterized protein
STRINGOGLUM04G24370.11e-147(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.19e-13TCP family protein