PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G32710.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 802aa    MW: 82832.3 Da    PI: 6.7008
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G32710.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-095936301954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  OGLUM03G32710.2 593 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 630
                      564459******************************88 PP

2BELL84.31.5e-274735242172
             BELL  21 krYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  OGLUM03G32710.2 473 SRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 524
                      69***********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-39410522IPR006563POX domain
PfamPF075268.2E-7415464IPR006563POX domain
PfamPF075261.7E-24473521IPR006563POX domain
PROSITE profilePS5007112.6571634IPR001356Homeobox domain
CDDcd000864.69E-13574635No hitNo description
SMARTSM003891.6E-9574638IPR001356Homeobox domain
SuperFamilySSF466892.74E-17576641IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28577640IPR009057Homeodomain-like
PfamPF059204.1E-18591630IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 802 aa     Download sequence    Send to blast
MERRRSRRQQ AFHPVAAEEE EEEGLVVVGR RSTADDGDSG AAGMGIAAPP CQPGQTTTFV  60
ISQPTSSKSS PAAIVVRPPA TASSSSMSHS QGFHQPSSGA VFGFSSDGFD GRPGSGQDHQ  120
QHEQQQQQHV AQQSRRDKLR VQGFDPAAAA AGHGLLPIEG DEHGADPGAM YDHAEAAAAG  180
ASNMLSEMFN FPSQPPTGPS ATELLASQMN ANYRFGFRQA AGLAGGEGGW FGGGGAAGRT  240
GLVLGGASLG SLGETSSPKQ QAGGMAGLAA DPAAAMHLFL MNPQQQQQQS RSSTSPPPSD  300
AQSAIHQHHE AFQAFGGAGA AAFGGGAAAG VVEGQGLSLS LSPSLQQLEM AKQAEELRVR  360
DGVLYFNRQQ QQQQAAAAAA SVQQQLPMAL HGQVGVLGQQ LHGGGYGGPA GIAGVLRNSK  420
YTRAAQELLE EFCSVGRGQI KGGGGRGSAP NNPNSSKAAA GAASSSGAAQ SPSRYNHYCD  480
QMQMVVNFFD SVMGFGAATP YTALAQKAMS RHFRCLKDAI AAQLRGTCEA LGEKDAGTGS  540
GLTKGETPRL RAIDQSLRQQ RAFHHMGIME QEAWRPQRGL PERSVNILRS WLFEHFLHPY  600
PSDADKHLLA RQTGLSRNQV SNWFINARVR LWKPMIEEMY QQECKELEGS SGAGDDPSGA  660
DDTHSPTTTA AAHHQHRHGQ LMVEHGGASS GGGAALSSHK HEPGVVAGPS SSSAAAVADA  720
AFVGIDPVEL LGGDGAAADD LYGRFDPAGA VRVRYGPAGA AAGGAAAAAG DVSLTLGLQH  780
AGAGNAGPDG SGRFSLRDYS GC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A8e-18580638159Homeobox protein Meis2
5bng_B8e-18580638159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1035500.0AC103550.13 Oryza sativa chromosome 3 BAC OSJNBa0079G12 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAK2874760.0AK287476.1 Oryza sativa Japonica Group cDNA, clone: J043023B19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631398.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLA0A0D9ZCP70.0A0A0D9ZCP7_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g52239.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-100BEL1-like homeodomain 2