PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G32330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 337aa    MW: 37253.8 Da    PI: 6.7382
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G32330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.2e-092602981755
                      HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      el +k +yps++++  LA+++gL+ +q+ +WF N+R ++
  OGLUM03G32330.1 260 ELHYKWPYPSESQKVALAESTGLDLKQINNWFINQRKRH 298
                      5566789*****************************885 PP

2ELK37.26.1e-13218239122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELKh+Ll+KYsgyL+sLkqE+s
  OGLUM03G32330.1 218 ELKHHLLKKYSGYLSSLKQELS 239
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012564.3E-28129180IPR005541KNOX2
PfamPF037919.6E-23135178IPR005541KNOX2
SMARTSM011881800138158IPR005539ELK domain
SMARTSM011884.9E-7218239IPR005539ELK domain
PfamPF037897.5E-10218239IPR005539ELK domain
PROSITE profilePS5121311.331218238IPR005539ELK domain
PROSITE profilePS5007112.617238301IPR001356Homeobox domain
SuperFamilySSF466892.48E-19239314IPR009057Homeodomain-like
SMARTSM003898.5E-13240305IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-27243302IPR009057Homeodomain-like
CDDcd000861.05E-12250302No hitNo description
PfamPF059202.7E-16258297IPR008422Homeobox KN domain
PROSITE patternPS000270276299IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MEEISHHFGV VGASGVHGGH QHQHQHHHHP WGSSLSAIVA PPPPPQPQQQ QTQAGGMAHT  60
PLTLNTATAA VGNPVLQLAN GSLLDACGKA KEASASASYA ADVGAPPEVA ARLTAVAQDL  120
ELRQRTALGG LGAATEPELD QFMEAYHEML VKYREELTRP LQEAMEFLRR VETQLNTLSI  180
SGRSLRNILS SGSSEEDQEG SGGETELPEI DAHGVDQELK HHLLKKYSGY LSSLKQELSK  240
KKKKGKLPKD ARQQLLNWWE LHYKWPYPSE SQKVALAEST GLDLKQINNW FINQRKRHWK  300
PSDEMQFVMM DGYHPTNAAA FYMDGHFIND GGLYRLG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402060.0FJ940206.1 Oryza sativa Japonica Group clone KCB522D03 homeobox protein mRNA, complete cds.
GenBankRICOSH10.0D16507.1 Oryza sativa Japonica Group OSH1 mRNA for homeobox protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629392.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotP466090.0KNOS6_ORYSJ; Homeobox protein knotted-1-like 6
TrEMBLA0A0D9ZCJ50.0A0A0D9ZCJ5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA009880-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.13e-78KNOTTED-like from Arabidopsis thaliana