PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G27120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 522aa    MW: 59862.1 Da    PI: 8.6737
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G27120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.51.6e-15361171198
                      HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       +++ +++p kf++++gg+   s t++l++++g  + v++  +k+++++vl+ GW+ Fv+a++++e+D+++F+++++s+f   v +f+
  OGLUM03G27120.1  36 DSRRSMIMPCKFVNHFGGD--FSGTIKLQSPNGILYVVEV--TKCKNKTVLRCGWEAFVDAHHIEENDSLLFRRVENSRF--EVLIFD 117
                      45566999*****888999..7779***************..*******************************8888888..888887 PP

2B338.42.1e-122373191798
                      E--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS..SEE..EEEEE- CS
               B3  17 vlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr..sefelvvkvfr 98 
                      v++  +ae h   +++s+t+tl+   ++++W  ++  rk  ++ +l++ W eFvk+n+++e D++ F  +++  ++f+++v+++r
  OGLUM03G27120.1 237 VISFCYAEVHF--PHKSVTVTLQRpCKSKKWHPRFYKRKDARMNILRGSWVEFVKDNRVQEQDICAFVPTKDarRNFTFTVHLLR 319
                      33333344443..56899******5677*******77888889************************966442577888887776 PP

3B344.82.2e-144305071090
                      HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
               B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      + ++++l l  +fa++  ++ ++  + ++ +++g++W   +++r + +r ++ +GW +Fv++n+L++ D+++F+++ +++ 
  OGLUM03G27120.1 430 SASRCQLELGARFAAAVHLPDRR--QTVVLQRRGERWATVMQIRSGTRRLLI-SGWHRFVRDNRLRVEDICLFEFKTHERW 507
                      345599********999888655..3666778*********88888877655.5********************8755444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-2322121IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.5E-2024120IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.19626119IPR003340B3 DNA binding domain
CDDcd100172.60E-1928117No hitNo description
SMARTSM010194.9E-1029119IPR003340B3 DNA binding domain
PfamPF023623.7E-1437117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-18212319IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-18213319IPR015300DNA-binding pseudobarrel domain
CDDcd100171.29E-16220319No hitNo description
SMARTSM010190.0046220321IPR003340B3 DNA binding domain
PROSITE profilePS5086310.475221321IPR003340B3 DNA binding domain
PfamPF023621.2E-10236319IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-19410513IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-17411514IPR015300DNA-binding pseudobarrel domain
CDDcd100175.36E-14416518No hitNo description
PROSITE profilePS5086311.152421515IPR003340B3 DNA binding domain
SMARTSM010190.0031422520IPR003340B3 DNA binding domain
PfamPF023624.1E-12431508IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MAGSGSCMKK SCVCCQKYLE HLDGKMNCFV RRMTADSRRS MIMPCKFVNH FGGDFSGTIK  60
LQSPNGILYV VEVTKCKNKT VLRCGWEAFV DAHHIEENDS LLFRRVENSR FEVLIFDSDD  120
CEKVFSCAGI RNTCKSIQEK SSSSCDDTAE SSESEGFARN QKGSFSHRED SPSEHESVES  180
GDLETSQEPY VLSRRSYLSE FQKEKVDALI QEIQPETTAF VAIMRKSNVQ LPTPFLVISF  240
CYAEVHFPHK SVTVTLQRPC KSKKWHPRFY KRKDARMNIL RGSWVEFVKD NRVQEQDICA  300
FVPTKDARRN FTFTVHLLRV AAAYSRGGTI VDRAGSSLGR TDVKSASEIS IKEEPIDQEE  360
NVSSRNRNGV SDESEEDEDS EGPAHPPYIV PCKSRLSRLQ KKIVEEKVRS IQSKFPVYVA  420
IMKKSNVERS ASRCQLELGA RFAAAVHLPD RRQTVVLQRR GERWATVMQI RSGTRRLLIS  480
GWHRFVRDNR LRVEDICLFE FKTHERWRLT MAVHAIFREQ CC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1193990.0AK119399.1 Oryza sativa Japonica Group cDNA clone:001-132-D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633049.10.0B3 domain-containing protein Os03g0619600
RefseqXP_015633050.10.0B3 domain-containing protein Os03g0619600
SwissprotQ6AV220.0Y3196_ORYSJ; B3 domain-containing protein Os03g0619600
TrEMBLA0A0D9ZAM40.0A0A0D9ZAM4_9ORYZ; Uncharacterized protein
STRINGOGLUM03G27120.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-16B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]