PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G04700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 596aa    MW: 63223.9 Da    PI: 6.6401
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G04700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-083523891954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +e+  LA+++gL+  qV++WF N R +
  OGLUM03G04700.1 352 FEHflHPYPKDSEKLMLARQTGLSRGQVSNWFINARVR 389
                      554459******************************88 PP

2BELL111.93.6e-36213283171
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                      erq+lq+k + L+ +l++Vd+rY++y++q+q+v+ssF+avag g+a+pYt+lAl++iSrhFr+L+dai  q
  OGLUM03G04700.1 213 ERQDLQNKVTALMAMLDQVDRRYRHYHHQMQIVMSSFDAVAGGGAARPYTALALQTISRHFRSLRDAIGAQ 283
                      799*****************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.4E-49140282IPR006563POX domain
PfamPF075264.2E-48145280IPR006563POX domain
PROSITE profilePS5007112.001330393IPR001356Homeobox domain
CDDcd000863.34E-12333394No hitNo description
SMARTSM003891.7E-9333397IPR001356Homeobox domain
SuperFamilySSF466894.71E-17334400IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27336399IPR009057Homeodomain-like
PfamPF059204.7E-17350389IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MATFFSSSTN QRDLTGGGGD GGDMSFQHYP PPSNPYSDSS AGGLIPLPAS IVSHSHIAHG  60
GGDEPAAFRE AATADGGEMG LQTQLLMAHG AAARGHQGGL SLSLGTQVPV SLYQYRPAGM  120
AAASLLSPSQ SSPMAGRSAQ NSIYVQNSRF LRAARELLDE VVNVRDAIKR KGDKNQGKDS  180
GECKGGDAAG DDKAGSNPQE QESNSAPELS PSERQDLQNK VTALMAMLDQ VDRRYRHYHH  240
QMQIVMSSFD AVAGGGAARP YTALALQTIS RHFRSLRDAI GAQAQAARRG LGEQDASAQG  300
GGGLSRLRYI DQQLRQQRAM QQFGMMQQPQ HAWRPQRGLP ESAVSVLRAW LFEHFLHPYP  360
KDSEKLMLAR QTGLSRGQVS NWFINARVRL WKPMIEEMYK EEFGTEMDSN SSSENGGKGK  420
DEAISSEDRD EFQSPSSAAA ARHAGVAGQL NNPFKSEAMG GAALDVGVGV VGLSSCLGGA  480
MGTYATGLNL NHHVHHPGAG GTSLLHDALH HHHHGGGGDA RFVSYGDMAD LGGGGGYDGG  540
SVSLTLGLQH CNNAGPVPAE QQGLLYGSAG DFDYINGSDD RQRFGPASQL LHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A9e-18339397159Homeobox protein Meis2
5bng_B9e-18339397159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0680340.0AK068034.1 Oryza sativa Japonica Group cDNA clone:J013131E13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630993.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotO656851e-114BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLA0A0D9Z2I10.0A0A0D9Z2I1_9ORYZ; Uncharacterized protein
STRINGBGIOSGA011390-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g06930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.12e-90BEL1-like homeodomain 7