PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G02410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 945aa    MW: 104933 Da    PI: 5.7264
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G02410.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.42.8e-28623673252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl+dl+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  OGLUM03G02410.1 623 EKTVSLQDLRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 673
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029612693IPR003035RWP-RK domain
PfamPF020427.0E-26625673IPR003035RWP-RK domain
SuperFamilySSF542771.03E-22845929No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-25845929No hitNo description
SMARTSM006662.0E-25847930IPR000270PB1 domain
PROSITE profilePS5174523.255847930IPR000270PB1 domain
PfamPF005641.2E-17848929IPR000270PB1 domain
CDDcd064074.04E-43848929No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 945 aa     Download sequence    Send to blast
MEQKPPPPPR REEEEEDGLM GCGMSGTGDI AGGDLDLMEE FLLATPGLDL SEFWHPGAAS  60
PFSPLFDIGS SVTTLTTPAP PAAEDDRDEA EMPSSGGGGG GGGLEVSPAH RGWTFQTAPQ  120
EVAVEPTVKE RLRRALERIA SQSQSQAQRG DGELLVQVWV PTRIGDRQVL TTCGQPFWLD  180
RRNQRLASYR TVSMKYQFSA DESARADLGL PGRVFVGRVP EWTPDVRYFS TEEYPRVQHA  240
QYFDIRGSVA LPVFEPRSRA CLGVVELVMT TQKVNYSAEI ENICNALKEV DLRSSDVSSD  300
PRSKVVDASY RAIIPEIMDV LRAVCDTHNL PLAQTWIPCI CQAKRGSRHS DESYKHCVST  360
VDEACYVRDR SVLGFHQACS EHHLFRGEGV VGRAFGTNEP CFSPDITTYS KTQYPLSHHA  420
KLFGLRAAVA IRLRSVKTGS LDFVLEFFLP MKCINTEEQR AMLNSLSNTI QQVCYTLRVV  480
KPKELVNDGP FEISQPTRPE FYAKSVHENL DELCSGINVP GRTTSLEASE EVSSWIASLV  540
DAQNKGGKGE IDVDLPFGFS KQDDEGFSVT AGWHTSPVMA PDGSMFSGFK RHEDYDVKEN  600
TCSSDPSNSN SDKAVEKRRT KTEKTVSLQD LRKHFAGSLK EAAKNLGVCP TTLKRICRQH  660
GINRWPSRKI KKVGHSLKKL QMVIDSVHGP EGTVQLSSLY ENFTKTTWSE RELQGDVHFP  720
ASEQNFQLEP SVPDRPCEGR FTSHTSGSNS ISPSCSQSSN SSLGCSSVPK TQQQHGSAPQ  780
LAVKEEISMD ENQCSTLIKS ASHEEAELQM FVEERPTMLF RSQSQVLLSE HKPIENLSNV  840
QKARSDSLKI KAIYGEERCI FRLQPSWGFQ RLKEEIVKRF GISQDTHVDL KYLDDESEWV  900
LLTCDADLLE CIDVYKSSSN QTVRILVNPS IQPLLNASFG QTGLS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000460.0AK100046.1 Oryza sativa Japonica Group cDNA clone:J013153P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629744.10.0protein NLP1
RefseqXP_015629745.10.0protein NLP1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A0D9Z1N00.0A0A0D9Z1N0_9ORYZ; Uncharacterized protein
STRINGOGLUM03G02410.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]