PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G01790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 314aa    MW: 34621.1 Da    PI: 6.0508
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G01790.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-072642972154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp+++++++L +++gL+ +q+ +WF N+R +
  OGLUM03G01790.1 264 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 297
                      469*****************************87 PP

2ELK25.43.3e-09218239122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK +L++++++++ ++++E++
  OGLUM03G01790.1 218 ELKIELKQGFKSRIEDVREEIL 239
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.0E-165195IPR005540KNOX1
PfamPF037901.6E-145393IPR005540KNOX1
SMARTSM012568.8E-25106161IPR005541KNOX2
PfamPF037919.5E-19109160IPR005541KNOX2
PROSITE profilePS512139.132218238IPR005539ELK domain
PROSITE profilePS5007111.693238301IPR001356Homeobox domain
SMARTSM003894.9E-10240305IPR001356Homeobox domain
SuperFamilySSF466895.56E-16240304IPR009057Homeodomain-like
CDDcd000861.49E-11241302No hitNo description
Gene3DG3DSA:1.10.10.604.8E-25245304IPR009057Homeodomain-like
PfamPF059201.1E-17258297IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MQGGDHGGME MGVGSFTGGG GGGECSSSSA TAAAAAAAAA AAAAAEAEER QLLKGEIAVH  60
PLCEQLVAAH VGCLRVATPI DHLPLIDAQL AQSSGLLHSY AAHHRPFLSP HDKQELDSFL  120
AQYMMLLCSF REQLQQHVRV HAVEAVMACR EIEQSLQDLT GATLEEGTGA TMSEDEEETA  180
PMLEGPMDMG SDGHDLMGFG PLMPTDSERS LMERVRQELK IELKQGFKSR IEDVREEILR  240
KRRAGKLPGD TTTILKQWWQ QHSKWPYPTE DDKAKLVEET GLQLKQINNW FINQRKRNWH  300
NNSQTSTLKS KRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1294313RKRNWHNNSQTSTLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0618190.0AB061819.1 Oryza sativa Japonica Group HOS66 mRNA for KNOX family class 2 homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628919.10.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotQ94LW30.0KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLA0A0E0CUF10.0A0A0E0CUF1_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9Z1E30.0A0A0D9Z1E3_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g03164.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0016000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-138KNOTTED-like homeobox of Arabidopsis thaliana 7