PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G26330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family DBB
Protein Properties Length: 268aa    MW: 28191.4 Da    PI: 5.3295
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G26330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.31.1e-06443538
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      C+ +  + ++ fC  ++  lC+ C    H+       H+
  OGLUM02G26330.1  4 QCDVCAAEAASVFCCADEAALCDACDRRVHRAnklagkHR 43
                     7*****************************7677777776 PP

2zf-B_box23.98.3e-086294335
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                     ++ C+ ++ek+  lfC++++  lC++C +  H 
  OGLUM02G26330.1 62 APLCDICQEKRGFLFCKEDRAILCRECDVPVHT 94
                     689*************************99884 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.6E-10147IPR000315B-box-type zinc finger
PROSITE profilePS501199.84147IPR000315B-box-type zinc finger
CDDcd000211.57E-6347No hitNo description
PfamPF006431.4E-5444IPR000315B-box-type zinc finger
PROSITE profilePS501199.68460107IPR000315B-box-type zinc finger
SMARTSM003364.1E-1160107IPR000315B-box-type zinc finger
PfamPF006432.3E-662102IPR000315B-box-type zinc finger
CDDcd000212.03E-76395No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MKVQCDVCAA EAASVFCCAD EAALCDACDR RVHRANKLAG KHRRFSLLNP SVSGRSPTST  60
TAPLCDICQE KRGFLFCKED RAILCRECDV PVHTASELTM RHSRYLLTGV RLSSEPAASP  120
APPSEEENSS SFCCSADDAV PAPAAPATSH GGSSGSSSIS EYLTTLPGWH VEDFLVDDAT  180
AEAAATAAAA AGISANGPCQ GVTRIGGLQE STGYPAWMAQ QQLCCDGLVA GDASPASRER  240
WVPQIYADQL AAGSKRSRTS TASSYSYW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0715070.0AK071507.1 Oryza sativa Japonica Group cDNA clone:J023090D24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623928.11e-164PREDICTED: B-box zinc finger protein 20
SwissprotQ9LQZ71e-51BBX21_ARATH; B-box zinc finger protein 21
TrEMBLA0A0D9YVN00.0A0A0D9YVN0_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g43170.11e-163(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23923679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39070.16e-36DBB family protein