PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G06260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 301aa    MW: 32715.8 Da    PI: 6.3532
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G06260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-072512842154
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      k +yp+++++++L +++gL+ +q+ +WF N+R +
  OGLUM02G06260.1 251 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 284
                      469*****************************87 PP

2ELK26.91.1e-09205226122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK++L+++Y+++L+++++E++
  OGLUM02G06260.1 205 ELKNELKQGYKEKLVDIREEIL 226
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-184084IPR005540KNOX1
PfamPF037901.7E-154380IPR005540KNOX1
SMARTSM012566.2E-2694149IPR005541KNOX2
PfamPF037914.4E-16102148IPR005541KNOX2
PfamPF037891.8E-6205226IPR005539ELK domain
SMARTSM011880.0023205226IPR005539ELK domain
PROSITE profilePS5121310.057205225IPR005539ELK domain
PROSITE profilePS5007111.353225288IPR001356Homeobox domain
SMARTSM003892.3E-10227292IPR001356Homeobox domain
SuperFamilySSF466897.27E-16227290IPR009057Homeodomain-like
CDDcd000861.57E-11228289No hitNo description
Gene3DG3DSA:1.10.10.609.4E-25232289IPR009057Homeodomain-like
PfamPF059208.2E-18245284IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAFHYPDHGL AMDPSSAAAS SPNPSFSPGG GGGVGVGGGE REKAAVAAHP LYERLLEAHV  60
ACLRVATPVD QLPRIDAQIA ARPPPLAAAS AAAAAGGPSG GEELDLFMTH YVLLLCSFKE  120
QLQQHVRVHA MEAVMGCWEL EQSLQSLTGA SPGEGTGATM SDDEDNQVDS EANMFDGNDG  180
SDGMGFGPLM LTEGERSLVE RVRHELKNEL KQGYKEKLVD IREEILRKRR AGKLPGDTAS  240
ILKAWWQAHS KWPYPTEDDK ARLVQETGLQ LKQINNWFIN QRKRNWHSNP ASSGEKTKKK  300
R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1281300RKRNWHSNPASSGEKTKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8354390.0CT835439.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA051K01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626238.10.0PREDICTED: homeobox protein knotted-1-like 2 isoform X2
SwissprotQ0E3C30.0KNOS2_ORYSJ; Homeobox protein knotted-1-like 2
TrEMBLA0A0D9YNC10.0A0A0D9YNC1_9ORYZ; Uncharacterized protein
STRINGORGLA02G0058000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-143KNOTTED1-like homeobox gene 3