PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G44090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 449aa    MW: 48388.8 Da    PI: 9.0809
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G44090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.18.7e-50591842128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + ++
  OGLUM01G44090.1  59 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAE 151
                      79***************************.89***************888889***************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkktLvfy+g+apkg++++W+m+eyrl
  OGLUM01G44090.1 152 NNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 184
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5558204IPR003441NAC domain
PROSITE profilePS5100555.24658205IPR003441NAC domain
PfamPF023651.7E-2460184IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MHMRRGRAAG GEGEAAAVVV MSRYDNNGHA AAAAAAAVAG GGGNKAAGEV DGHEDDLVMP  60
GFRFHPTEEE LIEFYLRRKV EGKRFNVELI TFLDLYRYDP WELPAMAAIG EKEWFFYVPR  120
DRKYRNGDRP NRVTASGYWK ATGADRMIRA ENNRPIGLKK TLVFYSGKAP KGVRSSWIMN  180
EYRLPPADTD RYHKTEISLC RVYKRTGIDD GHGHVSTARS SAHSRGGGAA PVQDNKQGSS  240
STSTPTPPPT PSKLHLLSSE CTSPPAIVTD HAAMAAHKAP SPRHHQQQQQ QLHAAKPCGG  300
YLQNSSMASA AGGDQQQQFQ QDFAAALYQQ YSKNTSGAFA STYSLLNLVN AASMGSSAAA  360
IDELSSLVGH GTPSYINPAA GSHNYSQFLH LPTTPSSHQP TPAPLGTTTA AAAATLPMSL  420
AAFSDRIWDW NNPIPEAGGR DYSTSTGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-546020519165NO APICAL MERISTEM PROTEIN
1ut4_B8e-546020519165NO APICAL MERISTEM PROTEIN
1ut7_A8e-546020519165NO APICAL MERISTEM PROTEIN
1ut7_B8e-546020519165NO APICAL MERISTEM PROTEIN
4dul_A8e-546020519165NAC domain-containing protein 19
4dul_B8e-546020519165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029020.0AK102902.1 Oryza sativa Japonica Group cDNA clone:J033113D13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631974.10.0NAC domain-containing protein 35
TrEMBLA0A0D9YIE60.0A0A0D9YIE6_9ORYZ; Uncharacterized protein
STRINGORGLA01G0337900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-101NAC domain containing protein 35