PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA12G0149800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 254aa    MW: 25607.3 Da    PI: 9.6174
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA12G0149800.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.86.3e-3552106660
             zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                         +cprC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrnvP+Gg++rk+ +
  ORGLA12G0149800.1  52 EQCPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPIGGSTRKRPR 106
                        68**************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.51252106IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3052104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2154103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MEAPLHQSPV PLLPPPPPPP RVVGVQQQQQ QQEAVVPPPP AMAAAAGGGG REQCPRCASR  60
DTKFCYYNNY NTAQPRHFCR ACRRYWTLGG SLRNVPIGGS TRKRPRPSRP ARAAIAAAAA  120
ASASGSQIAA QQQQAPPVVM SQHEAAAAAA AASGGGGGGG LLVSLLGAAP VLEGRLGGGI  180
GVDLLGGEQL GFGAMAMPPA PLLWPARVLE GGDAWKSAAA AAGVSYSPFP ALWQELAAAA  240
PVELAGGGGA PQLM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102106KRPRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA12G0149800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL9548290.0AL954829.6 Oryza sativa chromosome 12, . BAC OSJNBa0044E20 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878036.15e-91dof zinc finger protein MNB1A-like
TrEMBLI1R7J21e-174I1R7J2_ORYGL; Uncharacterized protein
STRINGORGLA12G0149800.11e-175(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-25DOF zinc finger protein 1