PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA12G0145700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 738aa    MW: 81304.9 Da    PI: 4.9526
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA12G0145700.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS360.62.2e-1103587301374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+ar+a+++s + ++l +++ts    ++ l+a++l+  +  + k
  ORGLA12G0145700.1 358 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARIAGTGSLVHQSLVAKRTS---AVDILQAYQLYMAAICFKK 446
                        6789***************************************************999999999999998...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        +s++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++R+Tg++ p++g   +e++eetg+rL+k+A+e+gvpf++n+++
  ORGLA12G0145700.1 447 VSFIFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRMTGIDLPQPGfrPTERIEETGHRLSKYAQEFGVPFKYNAIA 538
                        ************************************************************9*****************************99 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a ++e+++ e+L+++p+E+l+Vn+++q ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal +ysalfd l+a+
  ORGLA12G0145700.1 539 AVKMESVRKEDLNIDPDEVLIVNCQYQFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHAIVNGSFSAPFFVTRFREALFFYSALFDVLDAT 630
                        99****************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                         prese+r  +E+ ++gr++ nv+aceg +r+er et+++W+ r ++aGFk++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r 
  ORGLA12G0145700.1 631 TPRESEQRLLIEQNIFGRAALNVIACEGIDRVERPETYKQWQVRNQRAGFKQLPLNPEIVQVVRNKVKDCYHKDFVIDIDHQWLLQGWKGRI 722
                        ***********************************************************************889****************** PP

               GRAS 367 LvsvSaWr 374
                        L+++S W+
  ORGLA12G0145700.1 723 LYAISTWT 730
                        *******5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.733332710IPR005202Transcription factor GRAS
PfamPF035147.8E-108358730IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MGSSAADSFP AGGDDAIRDV YGIGGGGEED DPSLFLYLSD LAPVSPSAYL DLPPSPPPPT  60
TTATTMVKEG EEAPEDLVLP FISRMLMEED IDDKFFYDYP DNPALLQAQQ PFLEILSDPS  120
SNSRSSNSDD PRLSPTSSSD TSAAINSYDA AATATAVAAA AVPVPQYESI ELDPAAFFAA  180
ANSDLMSSAF LKGMEEANKF LPTENKLVID LEASSENNYL RGLEEAKRFL PSDDKLQVGF  240
AAAAAPVVSV KKEAVDVVVA TASGGGGRGR KNPYDDEELE LEGGRSSKQT AVQGDDVAAR  300
AMFDKVMMPS HENCTEMMEK LRIAMKEEAA KNEASAGGKG GNGKVKGGRR GGRDVVDLRT  360
LLIHCAQAVA TDDRRSATEL LKQIKQHAKP TGDATQRLAH CFAEGLQARI AGTGSLVHQS  420
LVAKRTSAVD ILQAYQLYMA AICFKKVSFI FSNQTIYNAS LGKKKIHIVD YGIQYGFQWP  480
CFLRRISQRE GGPPEVRMTG IDLPQPGFRP TERIEETGHR LSKYAQEFGV PFKYNAIAAV  540
KMESVRKEDL NIDPDEVLIV NCQYQFKNLM DESVVIDSPR DIVLSNIRKM QPHVFIHAIV  600
NGSFSAPFFV TRFREALFFY SALFDVLDAT TPRESEQRLL IEQNIFGRAA LNVIACEGID  660
RVERPETYKQ WQVRNQRAGF KQLPLNPEIV QVVRNKVKDC YHKDFVIDID HQWLLQGWKG  720
RILYAISTWT PNDALSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-443627298374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0E0JBD10.0A0A0E0JBD1_ORYNI; Uncharacterized protein
TrEMBLI1R9680.0I1R968_ORYGL; Uncharacterized protein
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-165GRAS family protein