PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA11G0190600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 593aa    MW: 66447.8 Da    PI: 6.4631
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA11G0190600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS289.11.2e-882145832373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        + lL++cA+a ++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+++++ly+     ++ +++ +e l+++kl+  ++ + k+
  ORGLA11G0190600.1 214 RLLLIQCAQATATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGKGKHLYQ-----NQMRMSLVEYLKVYKLYMAACCFTKV 300
                        568***************************************************9999994.....33446699****************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        + + a  +I++av+g++r+Hi+D++   Gl+Wp Ll+ L sR++gpp++RiT v+  ++     +++ee g+ L++ A+e++vpf+f++++a
  ORGLA11G0190600.1 301 ALMFAAMTIMQAVQGKKRLHIVDYGPRCGLHWPDLLRRLGSREDGPPEVRITIVDILQPAfrPFQRIEEAGHCLSSCANEFRVPFRFQAVAA 392
                        *******************************************************99998999**************************999 PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         ++e++  e+L+++p+E+l+Vn  l+   l+desv ++   +rd  L+ + +++P+v++    + ++ ++sFl rf   l yysalfd l+a
  ORGLA11G0190600.1 393 AKWETVGAEDLHIEPDEVLVVNDLLSFSALMDESVFSDGpnPRDVALRNISKMQPDVFIQGITNDSY-GASFLSRFRAVLLYYSALFDILDA 483
                        9*********************************98876669******************9999888.789********************* PP

               GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                        + pr+s  r  +E+ llg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r
  ORGLA11G0190600.1 484 TTPRDSGLRLALEQNLLGPYALNAIACEGADLVERPEKYKQWQARNHRAGMQQLKLRPDIVDTIRDEVNKYHHKDFLLGEDGQWLLQGWMGR 575
                        ************************************************************************888***************** PP

               GRAS 366 pLvsvSaW 373
                         L++ SaW
  ORGLA11G0190600.1 576 ILFAHSAW 583
                        ******** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.977187564IPR005202Transcription factor GRAS
PfamPF035144.3E-86214583IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENEAPS PPPVFFDLPA TPLSNSDGTD PSSLDNQLLS YVSRMLMEDE  60
MGSSAAITNL QCVNRGSTEE ANNMLPGSEV VRAFSKGMGE ASKLLPRNNS FRTLETVDQV  120
SSDGHCRGRK KKNHDRDEQQ LEEELGRSSK LAALTIAGTQ EAGARELLAE LMLHAHETCI  180
KDMEKLRIDM DNEAEKKINK KDKKGSSSKV VDLRLLLIQC AQATATDNQQ SAGELLKKIK  240
QHALATGDAM QRVAHYFAKG LEARLAGKGK HLYQNQMRMS LVEYLKVYKL YMAACCFTKV  300
ALMFAAMTIM QAVQGKKRLH IVDYGPRCGL HWPDLLRRLG SREDGPPEVR ITIVDILQPA  360
FRPFQRIEEA GHCLSSCANE FRVPFRFQAV AAAKWETVGA EDLHIEPDEV LVVNDLLSFS  420
ALMDESVFSD GPNPRDVALR NISKMQPDVF IQGITNDSYG ASFLSRFRAV LLYYSALFDI  480
LDATTPRDSG LRLALEQNLL GPYALNAIAC EGADLVERPE KYKQWQARNH RAGMQQLKLR  540
PDIVDTIRDE VNKYHHKDFL LGEDGQWLLQ GWMGRILFAH SAWVRQSQDT SSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-302175838374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235240LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616387.10.0PREDICTED: scarecrow-like protein 9
TrEMBLI1R2B40.0I1R2B4_ORYGL; Uncharacterized protein
STRINGORGLA11G0190600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-110GRAS family protein