PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA11G0190300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 638aa    MW: 71408.7 Da    PI: 5.1653
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA11G0190300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3412e-1042586332373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL++cA+av++gd + a++lL+++++++s +gd++qR+a +f+e+L+arla+++s++y++l +++ts   +++ l+a+klf  ++ i k+
  ORGLA11G0190300.1 258 HTLLIHCAQAVATGDWRSATELLKQIKQNSSARGDATQRMACCFAEGLEARLAGTGSQMYQSLVAKRTS---TVDFLKAYKLFTAACCIKKV 346
                        679************************************************************999999...8******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        s +  N++I++av+g +++Hi+D+++s+G+QWpaL+  L +R++gpp++R+Tg++ p++g   ++++eetg+rL+  A+++gvpf+f++ +a
  ORGLA11G0190300.1 347 SVIFSNKTIYNAVAGRRKLHIVDYGLSYGFQWPALFFLLGAREGGPPEVRMTGIDVPQPGfrPADQIEETGRRLSICARQFGVPFKFRA-IA 437
                        ***********************************************************9*****************************.79 PP

               GRAS 184 krledleleeLrvkp....gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                         ++e+++ e+L+++p    +E+l+Vn+ + l +l desv+++s  +rd vL+ +++++P+v+v +  +  ++++ F++rf eal +ysa fd
  ORGLA11G0190300.1 438 AKWETVRREDLHLDPeeeeEEVLVVNCLHGLNTLQDESVAVDSpsPRDVVLDNIRDMRPHVFVQCVVNGAYGAPFFVTRFREALFFYSAHFD 529
                        9*************9999999******************9998889********************************************** PP

               GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                        +l+a++pr++++r  +Er +lgr + nv+acega+r+ r et+++W+ r ++aG++++pl+ ++++ ++  ++  + + + ++ ++++l++g
  ORGLA11G0190300.1 530 MLDATIPRDNDDRLLIERDMLGRCALNVIACEGADRVDRPETYKQWQVRNHRAGLRQLPLEAEVVELVRGKVKSLYHKDFVIDVDHNWLLQG 621
                        ****************************************************************************888************* PP

               GRAS 362 WkdrpLvsvSaW 373
                        Wk+r L+++S W
  ORGLA11G0190300.1 622 WKGRILYAMSTW 633
                        ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.017231614IPR005202Transcription factor GRAS
PfamPF035147.1E-102258633IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MAAAPKPEEL VVAIEQPFSP SLFLDLPPTP HHDDDPNNVN DDLLLPFISR ILMEDDIDDK  60
FFYQFPDHPA LLQAQQSYAQ ILHAPATSSS SDDTTINNNT TNSTSVPDTL AMPDHDADTQ  120
SAPDDMEMLN MAFLKGREEA TKFLPTNNTL FSGFKAEPVL DIQPTFTFGP SGGGRGRKNR  180
HAEEDDLETE TSRSSKLMAP EHDDAAAADE IFDEIILNGY QMIIKGIDEL RVAMGSQSQA  240
DKNGRRASRA KTAVVDLHTL LIHCAQAVAT GDWRSATELL KQIKQNSSAR GDATQRMACC  300
FAEGLEARLA GTGSQMYQSL VAKRTSTVDF LKAYKLFTAA CCIKKVSVIF SNKTIYNAVA  360
GRRKLHIVDY GLSYGFQWPA LFFLLGAREG GPPEVRMTGI DVPQPGFRPA DQIEETGRRL  420
SICARQFGVP FKFRAIAAKW ETVRREDLHL DPEEEEEEVL VVNCLHGLNT LQDESVAVDS  480
PSPRDVVLDN IRDMRPHVFV QCVVNGAYGA PFFVTRFREA LFFYSAHFDM LDATIPRDND  540
DRLLIERDML GRCALNVIAC EGADRVDRPE TYKQWQVRNH RAGLRQLPLE AEVVELVRGK  600
VKSLYHKDFV IDVDHNWLLQ GWKGRILYAM STWVAHHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-362616338374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615829.10.0PREDICTED: scarecrow-like protein 9
TrEMBLI1R2B10.0I1R2B1_ORYGL; Uncharacterized protein
STRINGORGLA11G0190300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-143GRAS family protein