PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA11G0190200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 692aa    MW: 77332.2 Da    PI: 4.7558
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA11G0190200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS350.13.6e-1073046822373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL++cA+av+++d + a++lL+++++++s +gd++qRla +f+e+L+arla+++s++yk+l ++ ts   +++ l+a+klf  ++ i k+
  ORGLA11G0190200.1 304 HTLLIHCAQAVATSDRRSATELLKQIKQNSSARGDATQRLACCFAEGLEARLAGTGSQVYKSLVAKCTS---TVDFLKAYKLFAAACCIKKV 392
                        679**************************************************************9999...8******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        s++  N++Il+av+g++++Hi+D+++s+G+QWp L++ L++R++gpp++RiTg++ p++g   ++++eetg+rL++ A+++gvpf+f++ +a
  ORGLA11G0190200.1 393 SFIFSNKTILDAVAGKRKLHIVDYGLSYGFQWPGLFKCLSEREGGPPEVRITGIDFPQPGfrPADQIEETGRRLSNCARQFGVPFRFQA-IA 483
                        ***********************************************************9*****************************.79 PP

               GRAS 184 krledleleeLrvkp.......gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                         ++e+++ e+L++++       +E+l+Vn+ + l  l desv ++s  +rd vL+ +++++P+v+v +  +  ++++ Fl+rf e+l +ys+
  ORGLA11G0190200.1 484 AKWETVRREDLHLDReeeeeeeEEVLVVNCLHFLNALQDESVVVDSpsPRDMVLNNIRDMRPHVFVQCVVNGAYGAPFFLTRFRETLFFYSS 575
                        9**********9999999999999*****************98888779******************************************* PP

               GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                         fd+l+a++pr+++er  +Er +lgr++ nv+acega+r+ r et+++W  r ++aG++++pl+ ++++ ++  ++k + + + ++ ++++l
  ORGLA11G0190200.1 576 QFDMLDATIPRDNDERLLIERDILGRWALNVIACEGADRVDRPETYKQWLVRNHRAGLTQLPLQPQVVELVRDKVKKLYHKDFVIDVDHNWL 667
                        *******************************************************************************888********** PP

               GRAS 359 vlgWkdrpLvsvSaW 373
                        ++gWk+r L+++S W
  ORGLA11G0190200.1 668 LQGWKGRILYAMSTW 682
                        *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.806277663IPR005202Transcription factor GRAS
PfamPF035141.3E-104304682IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MAAAAPQLEE LVDLEPFSPS LFLDLPPTPH GDDPNDDDLI LPFISRMLME DDIDDKFFYQ  60
FPDHPALLHA QQPYAQILDA PSDDTTTNSS DDSASATTNN TTNSAAAANA SWPYDPVELS  120
QLLQSPPRPV SDNHDADVGD TRSAPEDDKD LKLLFSAADN MEMLNMAFLK GREEANKLVP  180
TNNTLFAGFD GASLLKTEPA VDEPTLMFGR SGGSGRGRKN RHGEEDDLEA ETGRSSKLMV  240
PPQEDTAAAS EMFDEIMFNG YEVIMKGMEE LRVAMDSEAE KKARNGGGAG RRAARAKAAV  300
VDLHTLLIHC AQAVATSDRR SATELLKQIK QNSSARGDAT QRLACCFAEG LEARLAGTGS  360
QVYKSLVAKC TSTVDFLKAY KLFAAACCIK KVSFIFSNKT ILDAVAGKRK LHIVDYGLSY  420
GFQWPGLFKC LSEREGGPPE VRITGIDFPQ PGFRPADQIE ETGRRLSNCA RQFGVPFRFQ  480
AIAAKWETVR REDLHLDREE EEEEEEEVLV VNCLHFLNAL QDESVVVDSP SPRDMVLNNI  540
RDMRPHVFVQ CVVNGAYGAP FFLTRFRETL FFYSSQFDML DATIPRDNDE RLLIERDILG  600
RWALNVIACE GADRVDRPET YKQWLVRNHR AGLTQLPLQP QVVELVRDKV KKLYHKDFVI  660
DVDHNWLLQG WKGRILYAMS TWVADRDHKS LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-363076828374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617900.10.0PREDICTED: scarecrow-like protein 9
TrEMBLI1R2B00.0I1R2B0_ORYGL; Uncharacterized protein
STRINGORGLA11G0190200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-139GRAS family protein