PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA11G0141300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 408aa    MW: 43855.9 Da    PI: 8.8111
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA11G0141300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.97.2e-23158201245
                WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         ep+rCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  ORGLA11G0141300.1 158 VEPRRCRRTDGKKWRCSRDAVGDQKYCERHINRGRHRSRKHVEG 201
                        59***************************************996 PP

2QLQ58.22.6e-20105141137
                QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                        ++FT++Q+++L++Q+l+yK++aan+ vP+ Ll++i++
  ORGLA11G0141300.1 105 GPFTPTQWMELEHQALIYKHIAANVSVPSSLLLPIRR 141
                        59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-12105141IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.888106141IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-14106140IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.136157201IPR014977WRC domain
PfamPF088793.5E-19159200IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MLSSCGGHGH GNPRSLQEEH HGRCGEQQGG GGGGGQEQEQ DGFLVREARA SPPSPSSSSF  60
LGSTSSCSGG GGGGQMLSFS SPNGTAGLGL SSGGSMQGVL ARVRGPFTPT QWMELEHQAL  120
IYKHIAANVS VPSSLLLPIR RSLHPWGWGS FPPGCADVEP RRCRRTDGKK WRCSRDAVGD  180
QKYCERHINR GRHRSRKHVE GRKATLTIAE PSMVIAAGVS SRGHTVARQK QVKVSAATVS  240
DPFSRQSNRK FLEKQNVVDQ LSPMDSFDFS STQSSPNYDN VALSPLKLHH DHDESYIGHG  300
AGSSSEKGSM MHESRLTVSK ETLDDGPLGE VFKRKNCQSA STEILTEKWT ENPNLHCPSG  360
ILQMATKFNS ISSGNTVNSG GTAVENLITD NGYLTARMMN PHIVPTLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1030550.0AK103055.1 Oryza sativa Japonica Group cDNA clone:J033117J15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615703.10.0PREDICTED: growth-regulating factor 8
SwissprotQ6AWY10.0GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLA0A0D3HMZ20.0A0A0D3HMZ2_9ORYZ; Uncharacterized protein
TrEMBLI1R0X10.0I1R0X1_ORYGL; Uncharacterized protein
STRINGORGLA11G0141300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-37growth-regulating factor 2