PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA11G0129300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 784aa    MW: 87524.5 Da    PI: 7.616
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA11G0129300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.2e-2480181199
                        EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   +
  ORGLA11G0129300.1  80 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--R 168
                        99*****************************7333.34459************************************************..4 PP

                        SSEE..EEEEE-S CS
                 B3  87 rsefelvvkvfrk 99 
                         +++el+v+v+r+
  ORGLA11G0129300.1 169 GENGELRVGVRRA 181
                        49999*****996 PP

2Auxin_resp116.52.4e-38206288183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        a+ha++t+++F+v+Y+Pr+s++eFvv++++++++lk+++s+GmRfkm+fe+e+++e+r++Gt+vg+ d+dp  Wp+SkWrsLk
  ORGLA11G0129300.1 206 AWHAVNTGTMFTVYYKPRTSPAEFVVPYDRYMESLKRNYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKWRSLK 288
                        89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-4273195IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.18E-4075209IPR015300DNA-binding pseudobarrel domain
CDDcd100176.15E-2278180No hitNo description
PROSITE profilePS5086311.89980182IPR003340B3 DNA binding domain
SMARTSM010199.9E-2480182IPR003340B3 DNA binding domain
PfamPF023621.2E-2180181IPR003340B3 DNA binding domain
PfamPF065071.1E-35206288IPR010525Auxin response factor
SuperFamilySSF542771.32E-11651732No hitNo description
PROSITE profilePS5174521.29656740IPR000270PB1 domain
PfamPF023092.0E-6702740IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
QVEASTNQVG EQRMQLYNLP WKILCEVMNV ELKAEPDTDE VYAQLTLLPE SKQQEDNGST  60
EEEVPSAPAA GHVRPRVHSF CKTLTASDTS THGGFSVLRR HADECLPPLD MSRQPPTQEL  120
VAKDLHGVEW RFRHIFRGQP RRHLLQSGWS VFVSAKRLVA GDAFIFLRGE NGELRVGVRR  180
AMRQQANVPS SVISSHSMHL GVLATAWHAV NTGTMFTVYY KPRTSPAEFV VPYDRYMESL  240
KRNYSIGMRF KMRFEGEEAP EQRFTGTIVG MGDSDPAGWP ESKWRSLKVR WDEASSIPRP  300
ERVSPWQIEP AVSPPPVNPL PVPRTKRLRP NATALPADSS AIAKEAATKV VVESEPNGTQ  360
RTFQTQENAT PKSGFGNSSE LESAQKSIMR PSGFDREKNN TPIQWKLGSD GRMQMSKPES  420
YSEMLSGFQP PKDVQTPQGF CSLPEQITAG HSNFWHTVNA QYQDQQSNHN MFPSSWSFMP  480
PNTRLGLNKQ NYSMIQEAGV LSQRPGNTKF GNGVYAALPG RGTEQYSGGW FGHMMPNSHM  540
DDTQPRLIKP KPLVVAHGDV QKAKGASCKL FGIHLDSPAK SEPLKSPSSV VYDGTPQTPG  600
ATEWRRPDVT EVEKCSDPSK AMKPLDTPQP DSVPEKPSSQ QASRNMSCKS QGVSTRSCKK  660
VHKQGIALGR SVDLTKFKGY EELIAELDDM FDFNGELKGP KKEWMVVYTD NEGDMMLVGD  720
DPWIEFCDMV HKIFIYTREE VQRMNPGTLN SRSEDSHANS MERGSVGREM RGCLSTSSLN  780
SENC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-153131051354Auxin response factor 1
4ldw_A1e-153131051354Auxin response factor 1
4ldw_B1e-153131051354Auxin response factor 1
4ldx_A1e-153131051354Auxin response factor 1
4ldx_B1e-153131051354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA11G0129300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under light or dark conditions and gravitropic stimulation of coleptile. {ECO:0000269|PubMed:12369618, ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3063060.0AJ306306.1 Oryza sativa subsp. japonica mRNA for auxin response factor 1 (arf1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617186.10.0auxin response factor 23 isoform X1
RefseqXP_015617187.10.0auxin response factor 23 isoform X1
SwissprotQ2R3F50.0ARFW_ORYSJ; Auxin response factor 23
TrEMBLI1R0K10.0I1R0K1_ORYGL; Auxin response factor
STRINGORGLA11G0129300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117836111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Contreras I,Ortiz-Zapater E,Castilho LM,Aniento F
    Characterization of Cop I coat proteins in plant cells.
    Biochem. Biophys. Res. Commun., 2000. 273(1): p. 176-82
    [PMID:10873582]
  2. Kobayashi-Uehara A,Shimosaka E,Handa H
    Cloning and expression analyses of cDNA encoding an ADP-ribosylation factor from wheat: tissue-specific expression of wheat ARF.
    Plant Sci., 2001. 160(3): p. 535-542
    [PMID:11166441]
  3. Ren H, et al.
    Combinative effects of a bacterial type-III effector and a biocontrol bacterium on rice growth and disease resistance.
    J. Biosci., 2006. 31(5): p. 617-27
    [PMID:17301500]
  4. Song Y,You J,Xiong L
    Characterization of OsIAA1 gene, a member of rice Aux/IAA family involved in auxin and brassinosteroid hormone responses and plant morphogenesis.
    Plant Mol. Biol., 2009. 70(3): p. 297-309
    [PMID:19266169]
  5. Kitajima A, et al.
    The rice alpha-amylase glycoprotein is targeted from the Golgi apparatus through the secretory pathway to the plastids.
    Plant Cell, 2009. 21(9): p. 2844-58
    [PMID:19767453]
  6. Kishimoto N, et al.
    Identification of the duplicated segments in rice chromosomes 1 and 5 by linkage analysis of cDNA markers of known functions.
    Theor. Appl. Genet., 1994. 88(6-7): p. 722-6
    [PMID:24186168]
  7. Sugano SS, et al.
    CRISPR/Cas9-mediated targeted mutagenesis in the liverwort Marchantia polymorpha L.
    Plant Cell Physiol., 2014. 55(3): p. 475-81
    [PMID:24443494]
  8. Kaneko K, et al.
    N-Glycomic and Microscopic Subcellular Localization Analyses of NPP1, 2 and 6 Strongly Indicate that trans-Golgi Compartments Participate in the Golgi to Plastid Traffic of Nucleotide Pyrophosphatase/Phosphodiesterases in Rice.
    Plant Cell Physiol., 2016. 57(8): p. 1610-28
    [PMID:27335351]