PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA11G0000600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WOX
Protein Properties Length: 201aa    MW: 22095.9 Da    PI: 8.7607
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA11G0000600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.1e-21666257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       ++R+++t+eql +Lee++++  r+p+a+e+++++++l    +++ ++V++WFqN++a+e++
  ORGLA11G0000600.1  6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66
                       58*****************99**************************************97 PP

2Wus_type_Homeobox121.73e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+
  ORGLA11G0000600.1  5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67
                       689***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.463267IPR001356Homeobox domain
SMARTSM003896.8E-6471IPR001356Homeobox domain
CDDcd000868.66E-4560No hitNo description
PfamPF000461.1E-18666IPR001356Homeobox domain
SuperFamilySSF466898.55E-12767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-8866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH  60
KARERQRLRR RLCARHQQQP SPPSSTVPPA PTAAAAGAVV QVHPAVMQLH HHHHHHHPYA  120
AAAAAQSHHL QQQQQAEWPA AVDYCSTASA SASATAADMA IPPCCRPLKT LELFPTKSTS  180
GGLKEDCCSS SKSSSCSTST N
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. Seems to act as repressor of YAB5. {ECO:0000269|PubMed:17351053}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA11G0000600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2188930.0AB218893.1 Oryza sativa Japonica Group mRNA for OsWOX3 protein, complete cds.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0004960.0BX000496.1 Oryza sativa chromosome 12, . BAC OSJNBa0096E03 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0005030.0BX000503.2 Oryza sativa chromosome 12, . BAC OSJNBb0077A02 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0725480.0BX072548.4 Oryza sativa chromosome 11, . BAC OSJNBa0029D01 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616762.14e-71WUSCHEL-related homeobox 3
RefseqXP_015619606.14e-71WUSCHEL-related homeobox 3
SwissprotA2ZH474e-72WOX3_ORYSI; WUSCHEL-related homeobox 3
SwissprotQ33DK14e-72WOX3_ORYSJ; WUSCHEL-related homeobox 3
TrEMBLA0A0D3HH351e-145A0A0D3HH35_9ORYZ; Uncharacterized protein
TrEMBLI1QWW41e-145I1QWW4_ORYGL; Uncharacterized protein
STRINGORGLA11G0000600.11e-146(Oryza glaberrima)
STRINGOBART11G00060.11e-146(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.17e-35WOX family protein
Publications ? help Back to Top
  1. Jiang G, et al.
    Regulation of inflorescence branch development in rice through a novel pathway involving the pentatricopeptide repeat protein sped1-D.
    Genetics, 2014. 197(4): p. 1395-407
    [PMID:24950892]
  2. Cheng S,Huang Y,Zhu N,Zhao Y
    The rice WUSCHEL-related homeobox genes are involved in reproductive organ development, hormone signaling and abiotic stress response.
    Gene, 2014. 549(2): p. 266-74
    [PMID:25106855]
  3. Niu L, et al.
    LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula.
    Plant J., 2015. 81(3): p. 480-92
    [PMID:25492397]
  4. Angeles-Shim RB, et al.
    A WUSCHEL-related homeobox 3B gene, depilous (dep), confers glabrousness of rice leaves and glumes.
    Rice (N Y), 2012. 5(1): p. 28
    [PMID:27234246]