PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA10G0081400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 430aa    MW: 45404.5 Da    PI: 8.2529
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA10G0081400.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.4e-3984143261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+l+cprC s++tkfCy+nny+++qPr+fCk C+ryWt+GGa+rnvPvG+grrknk++
  ORGLA10G0081400.1  84 PDKILPCPRCSSMDTKFCYFNNYNVNQPRHFCKHCQRYWTAGGAMRNVPVGAGRRKNKNA 143
                        7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3871141IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3186142IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.57488142IPR003851Zinc finger, Dof-type
PROSITE patternPS01361090126IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
GGGGDGLIKL FGKTIPVQPD AKDVQQHSGS SSSSTESDVQ ETAAVAVADP SPRSEVVDGE  60
SPPQPGGEAA SHQQQQKEMK LKKPDKILPC PRCSSMDTKF CYFNNYNVNQ PRHFCKHCQR  120
YWTAGGAMRN VPVGAGRRKN KNATAAAHFL HRVRACAAAA AMPAAPHDAT NATVLSFGGG  180
GGGHDAPPVT LDLADKMTRL GKEGLVAHAR NADAAAACSE VSSNRDDEQI GNTVAKPTNG  240
LQQHPPPPPH HHHSAMNGGG IWPYYTSGIA IPIYPAAPAY WGCMIPPPGA WSLPWPATVQ  300
SQAISSSSPP TSATPSVSSF TLGKHPREGG DHEARDHHGN GKVWVPKTIR IDNADEVARS  360
SIRSLFAFRG GDKADDNNDD DGTGVHKLAT TVFEPKRDGK TAKHPAITSL PLLHTNPVAL  420
TRSATFQEGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA10G0081400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0218930.0AC021893.18 Genomic Sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0060A14, from chromosome 10, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615013.10.0cyclic dof factor 1
TrEMBLI1QUD10.0I1QUD1_ORYGL; Uncharacterized protein
STRINGORGLA10G0081400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.14e-39cycling DOF factor 1