PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA09G0132500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 382aa    MW: 38856.2 Da    PI: 4.76
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA09G0132500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP100.13.9e-31122210594
                TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksa 94 
                          r+ ++h kv+gR+RR+R++++caar+ +L++eLG+++d++ti WL+qq++pai ++tgt++ +a ++ +++ +    ++s ++aa+ +
  ORGLA09G0132500.1 122 PPRNRDRHVKVEGRGRRIRMPVNCAARIGQLTRELGHKSDGETIRWLMQQSEPAIVAATGTGTVPAIAT-TVDGVLRIPTESPSAAARGD 210
                        5799*********************************************************99999444.44444444433333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136924.818125179IPR017887Transcription factor TCP subgroup
PfamPF036347.9E-26125204IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0048364Biological Processroot development
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MASQLQGKGA ETAAAGERVA PGTNAAAFAV LGYPPIQSPV ALQEEEGPRD AAFAGYAPIR  60
SPVVSRLQEK GEGEGEEEEV DKREEAGMAA DGSAFAAGMA LVPKPEPVAV EFLRGLAVAK  120
PPPRNRDRHV KVEGRGRRIR MPVNCAARIG QLTRELGHKS DGETIRWLMQ QSEPAIVAAT  180
GTGTVPAIAT TVDGVLRIPT ESPSAAARGD EPAPKRRRKL QPTRAAAGGP VEALAAAPPP  240
AVYYPIVADP LLQANGGGSI SISSGLAPAS SATPPTATGG GAIPFIAMPA TSDGGKQAMS  300
PATVWMVPPG GAGAVNQPIQ YWAFQPNPDH ANFAGASSYN VGQNPGVHEA SAADHAASTG  360
GGGGGGEDDE YEGMTDSSSD EE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213219PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00667PBMTransfer from GSVIVG01027588001Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA09G0132500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061750.0AP006175.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0669G04.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612634.10.0transcription factor PCF2-like
SwissprotA2YXQ12e-83PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH62e-83PCF2_ORYSJ; Transcription factor PCF2
TrEMBLI1QQJ60.0I1QQJ6_ORYGL; Uncharacterized protein
STRINGORGLA09G0132500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-41TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]